SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007984 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007984
Domain Number 1 Region: 290-564
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.44e-103
Family Mammalian PLC 0.000000355
Further Details:      
 
Domain Number 2 Region: 133-289
Classification Level Classification E-value
Superfamily EF-hand 1.74e-48
Family EF-hand modules in multidomain proteins 0.00047
Further Details:      
 
Domain Number 3 Region: 582-707
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.44e-31
Family PLC-like (P variant) 0.00014
Further Details:      
 
Domain Number 4 Region: 10-123
Classification Level Classification E-value
Superfamily PH domain-like 4.01e-26
Family Pleckstrin-homology domain (PH domain) 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007984   Gene: ENSPANG00000010296   Transcript: ENSPANT00000009745
Sequence length 716
Comment pep:known_by_projection chromosome:PapAnu2.0:12:80524725:80544743:1 gene:ENSPANG00000010296 transcript:ENSPANT00000009745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLLQDRLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPS
FSISDVETIRNGHDSELLRSLTEELPLEQGFTVVFHGRRSNLDLVANSVEEAQIWMRGLH
LLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLHLMNVEMDQEYAFSLFQ
AADTSQSGTLEGEEFVEFYKALTKRAEVQELFESFSADGQKLTLLEFLDFLREEQKERDC
TSELALELIDRYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQDMTQPLNHYF
ICSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDVWDGPSGEPVVYHGHTLTSRILF
KDVLATVAQYAFQELRRKILVKGKKLTLEEDLEYEEEEVEPGLEGEHESELALESQFETE
SEPEPQEQNLQIKDKKKKSKTILCPALSSLVIYLKSVSFRSFTHSKKHYHFYEISSFSET
KAKRLIKEAGNEFVQHNTWQLSRVYPSGLRTDSSNYNPQELWNAGCQMVAMNMQTAGLEM
DICDGHFRQNGGCGYVLKPDFLRDNQSSFHPERPISPFKAQTLLIQVISGQQLPKLNKTK
EGSIVDPLVKVQIFGVRLDTARQETNYVENNGFNPYWGQTLCFRVLVPELAMLRFVVMDY
DWKSRNDFIGQYTLPWSCMQQGYRHIHLLSKDGISLCPASIFVYICIREGLEGDES
Download sequence
Identical sequences ENSPANP00000007984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]