SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008008 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008008
Domain Number 1 Region: 743-815
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.77e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008008   Gene: ENSPANG00000009347   Transcript: ENSPANT00000015409
Sequence length 1234
Comment pep:novel chromosome:PapAnu2.0:6:74460116:74482314:1 gene:ENSPANG00000009347 transcript:ENSPANT00000015409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSYFKAAVSDLDKLLDDFEQNPDEQDYLQDVQNAYDSNHCSVSSELASSQPTSLLPRDQ
QCINSCASSETSYEINESSLNEKSLKGLTSIQNEKNVTGLDLLSSVDGGTSDEIQPLYMG
RCSKPICDLISDMGNLVHATNSEEDIKKLLPDDFKSNADSLIGLDLSSVSDTPCVSSTDH
DSDTVREPQNDTSSELQNREIGGIKELGIKVDTLSDSCNYSGTENLKDKKIFNHLEPIVD
FNMSSALTQQSSKMFDAKDKLQHKSQPCELLKDDGLVKEEVGVAVITAAECLKEEGKTSA
LTFSLPKNEDLCLNDLNSRDENFKLPDFSFQEDKTVIFIEQSAQEDSRNLDLKDNDVIQD
SSSALHVSGEDVQSSLSCLPVSGSMCGSLIESKARGDFLPQHEHKDNIQDAVTICEEIQN
SVVLGGEPFKETDLLKQEKCKNIVLQPLIEGMEDRKIDPDETVIRVASLDGGDTSCTVVE
SQEGLSGTNVLESSDCCEGFINTFSSIDMDGQDLDYFNIDEGTKSGTLISDAELDAFLTE
QYLQTTNVKSFEENVNDSKLQMNHIDMKDLDDGNINNIYFNAEAGAIGESHGINIICETV
DKQNAIENGLSLGEKSTIPIEQGLLTSKSEITNELSVSDTNSQSVGGARPKQLFGLPSRT
RSSKDLNKPDVPNTIESEPSIADTVVPVTCAVDSTADPQVSFNSNYIDIESNSEGGSSSL
TANEDSLPENTCKEGLVLGQKQPTWVPDSEAPNCMNCQVKFTFTKRRHHCRACGKVFCGV
CCSRKSKLQYLEKEARVCVVCYETISKAQAFERMMSPTGSNLKSNHSDECTIVQPPQENQ
TSSIPSPTTLPVSALKQPNVEGLYSKEQKRVWFADGILPNGEVADTTKLSSGSKRCSEDF
SPLSPDMPVTVNTVDHSHSTTVEKPNNETGDITRNEIIQSPISQVPSVEKLPINTGNEGL
PTSGSFTLDNDVFAEIEEPSSATVALVNSNLPIAGISDYRLLCDINKYVCNKISLLPNDE
DSLPPLLVASGEKGSVPVVEEHPSHEQIILLLEGEGFHPVTFVLNANLLVNVKFVFYSSD
KYWYFSTNGLHGLGQSEIIILLLRLPNEDTIPKDIFRLFITIYKDALKGKYIENLDSITF
TEIFLSSKDHGGFLFITPTFQKLDGLPLPSNPFLCGILIQKLEIPWAKVFPMRLMLRLGA
EYKAYPAPLTSIRGRKSLFGEIGHTIMNLLVVSN
Download sequence
Identical sequences ENSPANP00000008008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]