SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008015 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008015
Domain Number 1 Region: 53-322
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.11e-30
Family G proteins 0.023
Further Details:      
 
Domain Number 2 Region: 447-536
Classification Level Classification E-value
Superfamily EF-hand 7.88e-23
Family Eps15 homology domain (EH domain) 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008015   Gene: ENSPANG00000026345   Transcript: ENSPANT00000022120
Sequence length 543
Comment pep:known_by_projection chromosome:PapAnu2.0:19:41017651:41039443:1 gene:ENSPANG00000026345 transcript:ENSPANT00000022120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSWLKRGGARGQQPEAIRTVTSALKELYRTKLLPLEEHYRFGAFHSPALEDADFDGKPM
VLVAGQYSTGKTSFIQYLLEQEVPGSRVGPEPTTDCFVAVMHGDTEGTVPGNALVVDPDK
PFRKLNPFGNTFLNRFMCAQLPNQVLESISIIDTPGILSGAKQRVSRGYDFPAVLRWFAE
RVDLIILLFDAHKLEISDEFSEAIGALRGHEDKIRVVLNKADMVETQQLMRVYGALMWAL
GKVVGTPEVLRVYIGSFWSQPLLVPDNRRLFELEEQDLFRDIQGLPRHAALRKLNDLVKR
ARLVRVHAYIISYLKKEMPSVFGKENKKKQLILKLPVIFAKIQLEHHISPGDFPDCQKMQ
ELLMAHDFTKFHSLKPKLLEALDEMLTHDIAKLMPLLRQEELENTEVGVQGGAFEGTHMG
PFVERGPDEAMEDGEEGSDDEAEWVVTKDKSKYDEIFYNLAPADGKLSGSKAKTWMVGTK
LPNSVLGRIWKLSDVDRDGMLDDEEFALASHLIEAKLEGHGLPANLPRRLVPPSKRRHKG
SAE
Download sequence
Identical sequences A0A0A0MVW7 A0A0D9S2L7 A0A2K5JY87 A0A2K6LKU3 A0A2K6RF55 G7NNN2 Q4R9B5
ENSPANP00000008015 NP_001270364.1.63531 XP_007995560.1.81039 XP_010375696.1.97406 XP_014979849.1.72884 XP_017744678.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]