SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008069 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008069
Domain Number 1 Region: 275-428
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.61e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000641
Further Details:      
 
Domain Number 2 Region: 431-596
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000187
Further Details:      
 
Domain Number 3 Region: 36-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-33
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 4 Region: 148-265
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-33
Family Spermadhesin, CUB domain 0.0000203
Further Details:      
 
Domain Number 5 Region: 642-794
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.81e-28
Family MAM domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008069   Gene: ENSPANG00000011487   Transcript: ENSPANT00000014510
Sequence length 925
Comment pep:known_by_projection chromosome:PapAnu2.0:12:67646822:67759170:1 gene:ENSPANG00000011487 transcript:ENSPANT00000014510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMFPLTWVFLALYFSRHQVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSML
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTIL
AKPKMEIVLQFLIFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRS
STGILSLTFHTDMAVAKDGFSARYYLLHQEPLENFQCNVPLGMESGRIANEQISASSTYS
DGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKS
YKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIAL
RLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTHEYLWSPSAARLVSSRAGWFPRIPQ
AQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQD
PRTQQPKLFEGNMHYDTPDIRRFDPVPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT
VETLGPTVKSEETTTPYPTDEEATECGENCSFEDDKDLQLPSGFNCNFDFPEEPCGWMYD
HAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSRREGQYARLISPPVHLPRSPVCMEFQY
QATGGRGVALQVVREASQESKLLWVIREDQGGEWKHGRIILPSYDMEYQIVFEGVIGKGR
SGEIAIDDIRISTDVPLENCMEPISAFAVDIPEIHEREGYEDEIDDEYEVDWSNSSATSG
SGAPSTDKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSRSCTTLE
NYNFELYDGLKHKVKMNHQKCCSEA
Download sequence
Identical sequences A0A096N6G9
ENSPANP00000008069 XP_011847857.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]