SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008114 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008114
Domain Number 1 Region: 583-756
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.18e-48
Family Ypt/Rab-GAP domain of gyp1p 0.0033
Further Details:      
 
Domain Number 2 Region: 52-108
Classification Level Classification E-value
Superfamily RING/U-box 1.22e-19
Family RING finger domain, C3HC4 0.003
Further Details:      
 
Domain Number 3 Region: 738-835
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.2e-18
Family Ypt/Rab-GAP domain of gyp1p 0.026
Further Details:      
 
Domain Number 4 Region: 903-1040
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000603
Family Calmodulin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008114   Gene: ENSPANG00000003016   Transcript: ENSPANT00000014892
Sequence length 1339
Comment pep:known_by_projection chromosome:PapAnu2.0:6:173103368:173247556:-1 gene:ENSPANG00000003016 transcript:ENSPANT00000014892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITELRAWLIFYFIQKIRYTNARDRNQRRLGDAAKKAISKLTTRTVKKGDKETDPDFDHC
AVCIESYKQNDVVRILPCKHVFHKSCVDPWLSEHCTCPMCKLNILKALGIVVVTFFIETP
CPLGVWCMKANSPQSNLLWTCLLVGTLDVVLDSSARVAPYRILHQTQDSQVYWTVACGSS
RKEITKHWEWLENNLLQTLSIFDSEEDITTFVKGKIHGIIAEENKNLQPQGDEDPGKFKE
AELKMRKQFGMPEGEKLVNYYSCSYWKGRVPRQGWLYLTVNHLCFYSFLLGKEVSLVVQW
VDITRLEKNATLLFPESIRVDTRDQELFFSMFLNIGETFKLMEQLANLAMRQLLDSEGFL
EDKVLPRPVRPHRNISALKRDLDARAKNECYRATFRLPRDERLDGHTSCTLWTPFNKLHI
PGQMFISNNYICFASKEEDACHLIIPLREVTIVEKADSSSVLPSPLSISTKSKMTFLFAN
LKDRDFLVQRISDFLQKTPSKQPGSVVGSRKASVVDTNTESSPAPQEVPEQPASPASPLS
SRQSFCAQEVPTASQGLLKLFQKSSPVEDLGAKGAKEKMKEESWHIHFFEYGRGVCMYRT
AKTRALVLKGIPESLRGELWLLFSGAWNEMVTHPGYYAELVEKSTGKYSLATEEIERDLH
RSMPEHPAFQNELGIAALRRVLTAYAFRNPTIGYCQAMNIVTSVLLLYGSEEEAFWLLVA
LCERMLPDYYNTRVVGALVDQGIFEELTRDFLPQLSEKMQDLGVISSISLSWFLTLFLSV
MPFESAVVIVDCFFYEGIKVILQVALAVLDANMEQLLGCSDEGEAMTMLGRYLDNVVNKQ
SVSPPIPHLHALLTSGDDPPAEVDIFELLKVSYEKFSSLRAEDIEQMRFKQRLKVIQSLE
DTAKRSVVRAIPVDIGFSIEELEDLYMVFKAKHLASQYWGSSHTVAGRRDPSLPYLEQYR
IDASQFRELFASLTPWACGSHTPVLAGRMFRLLDKNKDSLINFKEFVTGMSGMYHGDLTE
KLKVLYKLHLPPALSPEEAESALEAAHYFTEDSSSEEALPQEEQEGSGGEDVQEKRGEEK
GTSSPDYRHYLRMWAKEKEAQKETIKDLPKMNQEQFIELCKTLYNMFSEDPMEQDLYHAI
ATVASLLLRIGEVGKKFSARTGRKPRDCATEEDEPPAPGPHQDAARELQPPAAGDPQAKA
GGDTHLGKAPQESQVVVEGGSGEGQGSPSQPLPDDEAKDDTSMSSYSVVSTGSLQCEDLT
DDTVLVGGEACSPTARIGGTVDTDWCISFEQILASILTESVLVNFFEKRVDIGLKIKDQK
KVERQFSTASDHEQPGASS
Download sequence
Identical sequences ENSPANP00000008114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]