SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008129 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008129
Domain Number 1 Region: 52-169
Classification Level Classification E-value
Superfamily C-type lectin-like 6.3e-32
Family C-type lectin domain 0.00000548
Further Details:      
 
Domain Number 2 Region: 265-331
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000528
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 210-275
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000334
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 4 Region: 170-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000117
Family EGF-type module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008129   Gene: ENSPANG00000020257   Transcript: ENSPANT00000005806
Sequence length 385
Comment pep:known chromosome:PapAnu2.0:1:192590981:192611328:-1 gene:ENSPANG00000020257 transcript:ENSPANT00000005806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCRRTREGPSKAMIFPRKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSENP
MNWQKARRFCRENYTDLVAIQNKAEIEYLEKTLPFSPSYYWIGIRKIGGIWTWVGTNKSL
TQEAENWGDGEPNNKKNKEDCVEIYIKRKKDAGKWNDDACHKPKAALCYTASCQPWSCSG
HGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEPPKLGTMDCTHPLGDFSFSSQCAFNC
SEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFSSACTF
SCSEGTELIGEKKTICESSGIWSNPNPICQKLDRSFSMIKEGDYNPLFIPVAVMVTAFSG
LAFIIWLARRLKKGKKSKKSMDDPY
Download sequence
Identical sequences A0A096N6M4 A0A2K5N2X0 A0A2K5W1G2 H9YUD6
XP_005539996.1.63531 XP_011946418.1.92194 ENSPANP00000008129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]