SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008168 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008168
Domain Number 1 Region: 593-854
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.33e-91
Family Eukaryotic proteases 0.00000000532
Further Details:      
 
Domain Number 2 Region: 340-446
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-29
Family Spermadhesin, CUB domain 0.00087
Further Details:      
 
Domain Number 3 Region: 227-332
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-19
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 4 Region: 87-170
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000222
Family SEA domain 0.01
Further Details:      
 
Domain Number 5 Region: 525-562
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000916
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 6 Region: 453-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000746
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 7 Region: 488-525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000115
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 8 Region: 564-604
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000743
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008168   Gene: ENSPANG00000001818   Transcript: ENSPANT00000019454
Sequence length 855
Comment pep:known_by_projection chromosome:PapAnu2.0:14:119044505:119097562:1 gene:ENSPANG00000001818 transcript:ENSPANT00000019454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSNQARKGGGGPKDFGAGLKYSSRHEKVNGLEEGVEFLPVNNVKKVEKHGPGRWVVLAA
VLIGLLLVSLGIGSLVWHLQYRDVRVQKIFNGYLRITNENFVDAYENSNSTEFVSLASKV
KDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVEEAERVMAEERVVM
LPPRARSLKSFVVTSVVAFPTDPKTVQRTQDNSCSFALHARGVEVMRFTTPGFPDSPYPA
HARCQWALRGDADSVLSLTFRSFDLASCDERGSDLVTVYNTLSPMEPHALVQLCGAYPPS
YNLTFLSSQNVLLITLITNTERRHPGFEATFFQLPKMSRCGGHLRKAQGTFNSPYYPGHY
PPNIDCTWNIEVPNNQHVKVRFKFFYLLEPGVPTGTCPKDYVEINGEKYCGERSQFVVTS
NSNKITVRFHSDQSYTDTGFLAEYLSYDASDPCPGQFTCRTGRCIRKEMRCDGWADCTDY
SDELNCSCDATHQFTCKNKFCKPLFWVCDSVNDCGDNSDEQGCSCPAQTFRCSNGKCLSK
SQQCDGKDDCGDGSDEASCPKVNVVTCTKHTYRCLNGLCLSKGNPECDGKKDCSDGSDEK
DCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHVCGASLISPNWLVSAAHCYID
DRGFRYSDPTQWTAFLGLHDQSQRSAPEVQERRLKRIISHPSFNDFTFDYDIALLELEKP
VEYSSVVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCESLL
PQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYT
RLPLFRDWIKEKTGV
Download sequence
Identical sequences A0A096N6P3
ENSPANP00000008168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]