SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008172 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008172
Domain Number 1 Region: 48-86
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000017
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008172
Domain Number - Region: 91-164
Classification Level Classification E-value
Superfamily Uracil-DNA glycosylase-like 0.0275
Family Single-strand selective monofunctional uracil-DNA glycosylase SMUG1 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008172   Gene: ENSPANG00000017882   Transcript: ENSPANT00000017413
Sequence length 338
Comment pep:known_by_projection chromosome:PapAnu2.0:19:232721:253148:1 gene:ENSPANG00000017882 transcript:ENSPANT00000017413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLPVPMPSAKMAAVEKRRPAVAPPAGFTDSGRQSVSRAAGAAESEEDFLRQVGVTEML
RAALLKVLEARPEEPIAFLAHYFENMGLRSPVNGGAGEPPGQLLLQQQRLGRALWHLRLA
HHSQRAAFNNNVSVAYECLSAGGRRKRPGLDGRTYSELLRRICRDGQAPEEVVAPLLRKV
QCRDHEAVPLSVFRAGTLTCFVLLEFVARAGALFQLLEDPVAAVADRRVGQAVLDTLEGA
LQASDAAAPARFLEAGSRLGPDSLALALDRAVGGRRPGAPMTREXXXXXXXXXXXXXXXX
XXRRPALRRRPGLPGSGRPLPKHLRGRPSAPAGAPAPR
Download sequence
Identical sequences ENSPANP00000008172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]