SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008178 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008178
Domain Number 1 Region: 42-204
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.87e-55
Family Cofilin-like 0.0000000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008178   Gene: ENSPANG00000023333   Transcript: ENSPANT00000027392
Sequence length 206
Comment pep:novel chromosome:PapAnu2.0:14:8252320:8254180:1 gene:ENSPANG00000023333 transcript:ENSPANT00000027392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APACSRGFHRVRDLEMLLLLSSGTAKHDADNTASSSSGGFVASGVAVSDGVIKVFNDMKV
RKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDC
RYALYDATYETKESKKEDLVFIFWAPECAPLKSKMIYASSKDAIKKKLTGIKHELQANCY
EEVKDRCTLAEKLGGSAVISLEGKPL
Download sequence
Identical sequences ENSPANP00000008178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]