SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008184 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008184
Domain Number 1 Region: 358-447,478-565
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 4-150
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.56e-17
Family BAR domain 0.062
Further Details:      
 
Domain Number 3 Region: 279-338
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000114
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008184   Gene: ENSPANG00000018247   Transcript: ENSPANT00000027859
Sequence length 944
Comment pep:known_by_projection chromosome:PapAnu2.0:1:95134096:95162880:-1 gene:ENSPANG00000018247 transcript:ENSPANT00000027859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSKKAKLLCMQRQDEYEKAKSSMFRAEEEHLSSSGALAKNLNKQLEKKRRLEEEALQKV
EEASELYKVCVTNVEERRNDLENTKREILTQLRTLVFQCDLTLKAVTVNLFNMQHLQAAS
LADSLQSLCDSAKLYDPGQEYSEFVKATNSTEEDKVDGNVNKHLNSSQTSGFGPANSLED
VVRLPDSSNKIEEDRCSNSADITGPSFIRSWTFGMFSDSESTGGSSESRSLDSESISPGD
FHRKLPRTPSSGTMSSADDLDEREPSSPSETGPNSLGTFKKTLMSKAALTHKFRKLRSPT
KCRDCEGIVVFQGVECEECLLVCHRKCLENLVIICGHQKLPGKIQLFGAEFTQVAKKEAD
GIPFILKICASEIENRALCLQGIYRVCGNKIKTEKLCQALENGMHLVDISEFSSHDICDV
LKLYLRQLPEPFILFRLYKEFIDLAKEIQHVNEEQETKKDSLEDKKWPNMCIEINRILLK
IKDLLRQLPASNFNSLHFLIVHLKRVVDHAEENKMNSKNLGVIFGPSLIRPRPTTAPITI
SSLAEYSNQARLVEFLITHSQKIFDGALQPQDVMCSTGVFSPQVDQGCFPKPLLSPEERD
PERSMKSLFFPSKEDIHTSESESKIFERATSFEESERKQNALEKWDACLSDKAQLLLDQE
VESASQKTEDGKTPKPLSLKSDRSSTNCVERHTPRTKIRPVSLPIDRLLLASPPKERNGR
NMGNVNLDKFCKNPAFEGVNRRDTATTVCSKFNGFDQQTLQKIQDKQYEQNSLTAKTTVI
MPSALQEKGVTTSLQISGDHSVNATQPSKPYTEPVRSVREASERRSSDSYPLAPVRAPRT
LQPQHWTTFYKPHAPAISIRGNEEKPASPSAAVPPGTAHDPQGLMVKSRPDPDKASACPG
QATGQPKEDSEELGLPDVNPTCQRPRLKRMQQFEDLEDEIPQFV
Download sequence
Identical sequences ENSPANP00000008184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]