SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008201 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008201
Domain Number 1 Region: 4-121
Classification Level Classification E-value
Superfamily EF-hand 8.02e-38
Family EF-hand modules in multidomain proteins 0.0057
Further Details:      
 
Domain Number 2 Region: 123-215
Classification Level Classification E-value
Superfamily EF-hand 1.18e-31
Family EF-hand modules in multidomain proteins 0.0025
Further Details:      
 
Domain Number 3 Region: 198-279
Classification Level Classification E-value
Superfamily RING/U-box 9.06e-20
Family ZZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008201   Gene: ENSPANG00000017000   Transcript: ENSPANT00000021380
Sequence length 606
Comment pep:known_by_projection chromosome:PapAnu2.0:13:24413995:24711346:-1 gene:ENSPANG00000017000 transcript:ENSPANT00000021380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHTTEISVSRL
ETVISSIYYQLNKRLPSTHQISVEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMCG
GKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTAVFEGPSFGYTEHSVRTCFPQQ
RKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCRCESMMGFRYRCQQC
HNYQLCQNCFWRGHAGGPHSNQHQMKEHSSWKSPAKKLSHAISKSLGCVPTREPPHPVFP
EQPEKPLDLAHIVPPRPLTNMNDTVVSHMSSGVPTPTKRLQYSQDIPCHLADEHALIASY
VARLQHCARVLDSPSRLDEEHRLIARYAARLAAEAGNVTRPPTDLSFNFDANKQQRQLIA
ELENKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQE
SRRELMVQLEELMKLLKEEEQKQAAQATGSPHTSPTHGGGRPMPMPVRSTSAGSTPTHCP
QDSLSGVGGDVQEAFAQGTRRNLRNDLLVAADSITNTMSSLVKELHSAEEGAEEEEEKMH
NGKDRG
Download sequence
Identical sequences ENSPANP00000008201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]