SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008218 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008218
Domain Number 1 Region: 229-509
Classification Level Classification E-value
Superfamily TPR-like 4.08e-30
Family Tetratricopeptide repeat (TPR) 0.005
Further Details:      
 
Domain Number 2 Region: 9-73,225-255
Classification Level Classification E-value
Superfamily TPR-like 0.0000308
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008218
Domain Number - Region: 169-231
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0778
Family Phosphate binding protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008218   Gene: ENSPANG00000026007   Transcript: ENSPANT00000023627
Sequence length 515
Comment pep:known_by_projection chromosome:PapAnu2.0:7:144932676:144986683:1 gene:ENSPANG00000026007 transcript:ENSPANT00000023627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSEMEPLLLAWSYFRRRKFQLCADLCTQMLEKSPYDQEPDPELPVHQAAWILKARALTE
MVYIDEIDVDQEGIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGSSQAVRPITQAGRPIT
GFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRL
NLTKYSQKPKLAKALFEYIFHHENDVKTALDLAALSTEHSQYKDWWWKVQIGKCYYRLGM
YREAEKQFKSALKQQEMVDTFLYLAKVYVSLDQPVTALNLFKQGLDKFPGEVTLLCGIAR
IYEEMNNMSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEIALRFYRRLLQMGIYNG
QLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHVAVGIGDTNLAHQCF
RLALVNNNHHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDKIGD
LQRSYVAAQKSEAAFPDHVDTQHLIKQLRQHFAML
Download sequence
Identical sequences A0A2I3N8B4
ENSPANP00000008218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]