SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008255 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008255
Domain Number 1 Region: 416-575
Classification Level Classification E-value
Superfamily Lipocalins 5.87e-47
Family Rv2717c-like 0.0000685
Further Details:      
 
Domain Number 2 Region: 1-88
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.98e-21
Family THAP domain 0.00034
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008255
Domain Number - Region: 298-390
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0915
Family MED7 hinge region 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008255   Gene: ENSPANG00000020992   Transcript: ENSPANT00000016801
Sequence length 577
Comment pep:known_by_projection chromosome:PapAnu2.0:12:103380122:103425683:-1 gene:ENSPANG00000020992 transcript:ENSPANT00000016801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVICCAAVNCSNRQGKGEKRAVSFHRFPLKDSKRLIQWLKAVQRDNWTPTKYSFLCSEHF
TKDSFSKRLEDQHRLLKPTAVPSIFHLTEKKRGAGGHGRTRRKDASKATGGVRGHSSAAT
GRGATGWSPSSSGNPMAKPESRRLKRAALQGEAAPRAAQEAASQEQAQQALERTPGDGLA
TTVAGSQGKAEVSATDAGDESTTPSIEGGVADKSGISMDDFTPPGSGACKFIGSLHSYSF
SSKHTRERPSVPREPIDRKRPKKDVEPSCSGSSLGPDKGLAQSPPGSSLTATPQKPSQSP
SAPPADVTPKPATEAVQSQHSDASPMSINEVILSASGACKLIDSLHSYCFSSRQNKSQVC
CLREQVEKKNGELKSLRQRVSRSDSQVRKLQEKLDELRRVSVPYPSGLLSPSREPPKMNP
VVEPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPDTRKPMH
RECGFIRLKPDTNKVAFVSAQNTGVVEVEEGEVNGQELCIASHSIARISFAKEPHVEQIT
RKFRLNSEGKLEQTVSMATTTQPMTQHLHVTYKKVTP
Download sequence
Identical sequences A0A096N6X4 A0A2K5VZZ8 H9FV67
XP_005574945.1.63531 XP_014967050.1.72884 ENSPANP00000008255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]