SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008309 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008309
Domain Number 1 Region: 173-204
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 2 Region: 56-161
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000507
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008309   Gene: ENSPANG00000017235   Transcript: ENSPANT00000017637
Sequence length 270
Comment pep:known_by_projection chromosome:PapAnu2.0:1:24044439:24052967:1 gene:ENSPANG00000017235 transcript:ENSPANT00000017637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEACLLQLPQRLLLLGAAALTATALETADLADLCGQTWQGDGLLLRSHAASLRFYFVAPD
TDCWLWMQAAAPGDWIRFQFRFFLVYSLTPAPPALNTSSPAPAGPCAPGSYLQFYEGPPG
APRPLGSALCGLTIPVPVASSGPFLGLRLVTRGRQPRVDFVGEGTSFRLGPCGAYFRCQN
GRCIPSSLVCDPWGMDNCGDGSDQGSWPPADCRGPSPVASETGSTDHHTSSSPTPSPALG
SAGSLRIAAERSPPAGRDPTRQDAALEGYT
Download sequence
Identical sequences ENSPANP00000008309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]