SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008318 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008318
Domain Number 1 Region: 224-311
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.81e-20
Family SCOPe 0.0000702
Further Details:      
 
Domain Number 2 Region: 162-184
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000351
Family CCCH zinc finger 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008318   Gene: ENSPANG00000011297   Transcript: ENSPANT00000006627
Sequence length 420
Comment pep:known_by_projection chromosome:PapAnu2.0:6:144254234:144263792:-1 gene:ENSPANG00000011297 transcript:ENSPANT00000006627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPG
VRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQN
MEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECP
YRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRASTMPRLDPPEDKTITTLYVGGLG
DTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV
KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYFNLPPSGPPAV
VNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPGPIHYPSQDPQRMGAHAGKHSSP
Download sequence
Identical sequences A0A096N735 A0A0P6JBH5 A0A1U7QIN5 A0A1U7TVT4 A0A250Y0K3 A0A2K5HTL7 A0A2K5NNP0 A0A2K5Z0B5 A0A2K6CJJ1 A0A2K6MK02 A0A2K6R5N5 F2Z4G3 F6PL59 G1LD30 G1PCS9 G1RHG3 G1T1G7 G3RAZ8 G3SYJ2 H0UXE0 H2PH39 H2QRT5 M3WPJ5 M3YQP8 Q4R4J1 Q8BHS3 Q9NW64
5mqf_P 5xjc_O 5yzg_O 5z56_O 5z57_O 6ff4_P ENSP00000412118 ENSMUSP00000025506 ENSNLEP00000012663 ENSMLUP00000008238 ENSTTRP00000012121 ENSCPOP00000001755 ENSNLEP00000012663 ENSAMEP00000004811 ENSCPOP00000001755 ENSP00000199814 ENSMPUP00000013657 ENSBTAP00000040478 ENSPTRP00000029773 ENSPPYP00000017855 ENSDORP00000004985 10090.ENSMUSP00000025506 10141.ENSCPOP00000001755 9598.ENSPTRP00000029773 9600.ENSPPYP00000017855 9606.ENSP00000199814 9913.ENSBTAP00000036633 9913.ENSBTAP00000040478 9986.ENSOCUP00000009916 ENSBTAP00000040478 ENSLAFP00000005577 ENSTTRP00000012121 ENSDNOP00000008664 ENSFCAP00000016167 gi|8922328|ref|NP_060517.1| ENSMLUP00000008238 ENSPANP00000008318 ENSPVAP00000013412 ENSPVAP00000013412 ENSMUSP00000025506 ENSPTRP00000029773 ENSAMEP00000004811 ENSOCUP00000009916 ENSMPUP00000013657 ENSDORP00000004985 ENSPPYP00000017855 ENSLAFP00000005577 ENSMUSP00000025506 ENSP00000199814 NP_001244425.1.72884 NP_001273072.1.63531 NP_060517.1.87134 NP_060517.1.92137 NP_080052.1.92730 XP_001167240.1.37143 XP_002710359.1.1745 XP_003266703.1.23891 XP_003404652.1.64505 XP_003477406.1.53824 XP_003829060.1.60992 XP_003981441.1.62641 XP_004042882.1.27298 XP_004280390.1.21590 XP_004323703.1.83887 XP_004428697.1.5094 XP_004472054.1.11602 XP_004652603.1.11716 XP_004854489.1.39548 XP_005074756.1.91757 XP_005683233.1.57651 XP_005897396.1.15283 XP_005953945.1.78601 XP_006042081.1.26621 XP_006089199.1.53796 XP_006150960.1.99106 XP_006174691.1.101512 XP_006204502.1.17985 XP_006893749.1.29581 XP_006906470.1.64745 XP_007093460.1.5354 XP_007118431.1.24612 XP_007188695.1.59432 XP_007448104.1.90284 XP_007615694.1.28591 XP_007941816.1.48129 XP_008013211.1.81039 XP_008061940.1.4292 XP_008150441.1.99482 XP_008515452.1.77740 XP_008585435.1.73410 XP_008690727.1.72690 XP_008847624.1.79516 XP_010371960.1.97406 XP_010625494.1.5607 XP_010960110.1.22495 XP_010989458.1.51371 XP_011221831.1.58354 XP_011369492.1.92234 XP_011714270.1.29376 XP_011786989.1.43180 XP_011840714.1.47321 XP_011924209.1.92194 XP_011968818.1.54773 XP_012646643.1.48125 XP_012906136.1.14098 XP_014708134.1.49734 XP_015341825.1.40921 XP_015974192.1.101085 XP_017532965.1.32401 XP_017731249.1.44346 XP_019319980.1.44245 XP_020740808.1.74333 XP_021070165.1.100879 XP_021489342.1.76796 XP_021552801.1.83697 XP_546302.2.84170 ENSOCUP00000009916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]