SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008338 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008338
Domain Number 1 Region: 8-130
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.54e-17
Family Single strand DNA-binding domain, SSB 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008338   Gene: ENSPANG00000000427   Transcript: ENSPANT00000020284
Sequence length 1004
Comment pep:known_by_projection chromosome:PapAnu2.0:14:72894779:72929639:1 gene:ENSPANG00000000427 transcript:ENSPANT00000020284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRRRKFLLASVLALQNSSFIYPSCQKCFSRIILVSKRSKCPKCGCTGESGNANYRYKLS
LKVAESNKLSVITVFGSCLDTFFGLTASGLYRYIQDPNKIPETLDNDTTQNLLTKAVETC
FVGQSFIFGVTNFESHPGQGADASNFLQQCSDHKRKARSLVACQIVLPDPGVAGFTVIDY
FCQLLQTFNFRKLQCDSHAPNNHLLSLDHSNSDLSSIYTSDSTSYFFKSCSKDTFSKFWQ
PSLEFTSIVSKLTDNDDFSASEQSKAFGTLQQNRNSISIAEATGSSSCHDPIQHSWSLVS
YMDKKSTAEKLGKELGLQAKELSAVHSSHHEIGVNDSNLFSLEMREPLESSNTKSFHSAV
EIKNRSQHEPPCFQHHGIDTPTSLQKRSTCCPPSLVRLEVTASNSQDGDPQIWDDLPFSE
SLNKFLAVLESEIAITQADVSSRKHHVDNDIDTFHADHSRLSVTPQRTTGALHTPPIALR
SSQAIVKANCSKDDFLFNCKVNLSPSVEKESQPDNKVEAVSVNHSGRGMSEYFLPNPCLS
ALFSSSKDSETIVTLKKTIRISPPRDEILFRPSTSESDHFSLNNKYLNGCGEKSLSVMNE
KLTTLCSRKYNDVSDLCKLENKQYYRWSKNQDDSFTICRKLTYPLETLCNSPNRSTNTLK
EMPWGHINNNLTQSYSIGYEGSYDASADLFDDIAKEMDIATEITKKSQEILLQQGTSLAE
SHPSESDFSLRSLSEDFIQPSQKLSLQSISGSRRSRTCSPTPQFQSDSEYNVENSQDFVP
CSQSTPISGFHQTRIHGINRAFKKPVFYSDLDANYEKIRIFPENDKQQASPSCPKNIKTP
SQKIRSPIVSGISQPEVFNPSPFAECHETDSDEWVPPTTQKIFPSDMLGFQVIGLGKCLA
AHHFPDQELPRKKLKHIRQGTNKGLIKKKLKNMLTAVVMKEKTPKYNCKSSGWISKCPDI
QVLAAPQLHPILGPDSCLECCLPFSEKGPPSVCDTQSAWSPELF
Download sequence
Identical sequences A0A096N751
ENSPANP00000008338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]