SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008343 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008343
Domain Number 1 Region: 257-349
Classification Level Classification E-value
Superfamily EF-hand 1.68e-18
Family EF-hand modules in multidomain proteins 0.0000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008343   Gene: ENSPANG00000002503   Transcript: ENSPANT00000006048
Sequence length 447
Comment pep:known_by_projection chromosome:PapAnu2.0:14:47649293:47686348:-1 gene:ENSPANG00000002503 transcript:ENSPANT00000006048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVTFGMLVYSVKTSFHDFTIIISLFQMRWRTILLQYCFLLITCVLTALEAVPIDIDKTK
VQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELD
LVSHHVRTKLDELKRQEVGRLRMLIKAKLDSLQDIGMDHQALLKQFDHLNHLNPDKFEST
DLDMLIKAATSDLEHYDKTRHEEFKKYEMMKEHERREYLKTLNEEKRKEEESKFEEMKKK
HENHPKVNHPGSKDQLKEVWEETDGLDPNDFDPKTFFKLHDVNSDGFLDEQELEALFTKE
LEKVYDPKNEEDDMVEMEEERLRMREHVMNEVDTNKDRLVTLEEFLKATEKKEFLEPDSW
ETLDQQQFFTEEELKEYENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVI
QQMEQKKLQQGIPPSGPAGELKFEPHI
Download sequence
Identical sequences ENSPANP00000008343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]