SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008349 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008349
Domain Number 1 Region: 59-367,469-506
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.91e-63
Family FAD-linked reductases, N-terminal domain 0.00026
Further Details:      
 
Domain Number 2 Region: 348-454
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.07e-28
Family L-aminoacid/polyamine oxidase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008349   Gene: ENSPANG00000007273   Transcript: ENSPANT00000008359
Sequence length 567
Comment pep:known_by_projection chromosome:PapAnu2.0:19:43142296:43149160:-1 gene:ENSPANG00000007273 transcript:ENSPANT00000008359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLALRLLVLVPILLSLADSRDWKAERSQDPFEKCMQDPDYEQLLEVVTWGLNRTLKPQ
RVIVVGAGVAGLVAAKMLSDAGHKVTILEADNRIGGRIFTYRDQNTGWIGELGAMRMPSS
HRILHKLCQGLGLNLTKFTQYDKNTWTEVHEVKLRNYVVEKVPEKLGYALRPQEKGQSPE
DIYQMALNQALKDLKALGCRKAMKKFERHTLLEYLLGEGNLSRPAVQLLGDVMSEDGFFY
LSFAEALRAHSCLSDRLQYSRIVGGWDLLPRALLSSLSGLVLLNAPVVAMTQGPHDVHVQ
IDTSPPARNLKVLKADVVLLTASGPAVKRITFSPPLPRHMQEALRRLHYVPATKVFLSFR
RPFWREEHIEGGHSNTDRPSRMIFYPPPREGALLLASYTWSDAAAAFAGLSREEALRLAL
DDVAALHGPLVRQLWDGTGVVKRWAEDPHSQGGFVVQPPALWQTEKDYWRVPYGRIYFAG
EHTAYPHGWVETAVKSALRAAIKINSRKGPASDTASPTGHASDTEGQGHVHGVAGSPSHD
LAKEEGSHPAAQGQLSLQHMTHTRTLY
Download sequence
Identical sequences A0A0A0MW10
ENSPANP00000008349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]