SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008350 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008350
Domain Number 1 Region: 7-345
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.89e-100
Family Calpain large subunit, catalytic domain (domain II) 0.000000369
Further Details:      
 
Domain Number 2 Region: 358-497
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 2.75e-33
Family Calpain large subunit, middle domain (domain III) 0.00034
Further Details:      
 
Domain Number 3 Region: 519-631
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.55e-16
Family Synaptotagmin-like (S variant) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008350   Gene: ENSPANG00000014280   Transcript: ENSPANT00000003145
Sequence length 641
Comment pep:known_by_projection chromosome:PapAnu2.0:X:100332541:100357868:-1 gene:ENSPANG00000014280 transcript:ENSPANT00000003145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPPLKLFKNQKYQELKQECVKDSRLFCDPTFLPENDSLFYNRLLPGKVVWKRPQDICDD
PRLIVGNISNHQLTQGRLGHKPMVSAFSCLAVQESHWTKTIPNHKEQEWDPQKTDKYAGI
FRFRFWHFGEWTEVVIDDLLPTINGDLVFSFSTSMNEFWNALLEKAYAKLLGCYEALDGL
TITDIIVDFTGTLAETVDMQKGRYTELVEEKYKLFGELYKTFTKGGLICCSIESPNQEEQ
EVETDWGLLKGHTYTMTDIRKIRLGERLVEVFSAEKLYMIRLRNPLGRQEWSGPWSEISE
EWQQLTAGDRKNLGLVMSDDGEFWMSLEDFCRNFHKLNVCRNVNNPIFGRKELESVLGCW
TVDDDPLMNRSGGCYNNRDTFLQNPQYIFTVPEDGHKVIMSLQQKDLRTYRRMGRPDNYI
IGFELFKVEMNRKFRLHHLYIQERAGTSTYIDTRTVFLSKYLKKGNYVLVPTMFQHGRTS
EFLLRIFSEVPVQLRELTLDMPKMSCWNLARGYPKVVTQITVHSAEDLEKKYANETVNPY
LVIKCGKEEVRSPVQKNTVHAIFDTQAIFYRRTTDIPIIVQVWNSRKFCDQFLGQVTLDA
DPSDCRDLKSLYLRKKGGPTAKVKQGHISFKVISSDDLTEL
Download sequence
Identical sequences A0A096N760 A0A0D9R8W1 A0A2K5KK00 A0A2K6AD07 A0A2K6BZZ6 G7NT58 G7Q3H2
ENSPANP00000008350 XP_007990772.1.81039 XP_011754457.1.29376 XP_011839890.1.47321 XP_011943088.1.92194 XP_014983509.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]