SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008353 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008353
Domain Number 1 Region: 169-202
Classification Level Classification E-value
Superfamily SAP domain 0.000000421
Family SAP domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008353   Gene: ENSPANG00000022678   Transcript: ENSPANT00000001132
Sequence length 415
Comment pep:known_by_projection chromosome:PapAnu2.0:19:41989757:41995519:-1 gene:ENSPANG00000022678 transcript:ENSPANT00000001132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLAASSQRSQIIRSKFRSELTLRIHRRNQEQISDPDPWISASGPLLAPALPSGTAPFLF
SPGVLLPEPEYCPPWRSPKKESPKISQRWRESKPRGNLTYHQYMPPEPRQGSRADPAEGS
ALGPPGPPLWEGTDSQQPHPRMKPCVLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELR
QQLRLRGLPVSGTKSMLLERMRGGAPPRERPKPRREDSPAGAPWPRLRPKALAAARRQGS
VKPSAASHRPPLPRAVDTPGTAPAPTTTSAPAAAPALNPSSAPGSPALTLEEELQEAIRR
AQQLLPNRGIDDILEDQVEPDDPLPPIPLDFPGSFDVLSPSPDSEGLSSVFSSSLPSPTN
SSSPSPRDPTDSLDWLEALSGGPPLGSGPPPPSIFSADLSDSSSSRLWDLLEDPW
Download sequence
Identical sequences ENSPANP00000008353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]