SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008383 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008383
Domain Number 1 Region: 63-207
Classification Level Classification E-value
Superfamily TPR-like 3.13e-29
Family Tetratricopeptide repeat (TPR) 0.00000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008383   Gene: ENSPANG00000025667   Transcript: ENSPANT00000008024
Sequence length 209
Comment pep:known_by_projection chromosome:PapAnu2.0:5:148178692:148184734:-1 gene:ENSPANG00000025667 transcript:ENSPANT00000008024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVHFYNLGLFLQLCIIAECGELKEGDDWGIFPKDGSGDSHPDFPEDADVDLKDVDKILL
ITEDLKNIGNTFFKSQNWEMAIKKYAKVLRYVDSSKAVIETADRAKLQPIALNCVLNIGA
CKLKMSNWQGAIDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPEDK
AIQAELLKVKQKIKAQKDKEKAVYAKMFA
Download sequence
Identical sequences ENSPANP00000008383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]