SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008387 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008387
Domain Number 1 Region: 302-345,395-503
Classification Level Classification E-value
Superfamily TPR-like 2.68e-22
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 
Domain Number 2 Region: 133-304
Classification Level Classification E-value
Superfamily TPR-like 9.7e-22
Family Tetratricopeptide repeat (TPR) 0.0042
Further Details:      
 
Domain Number 3 Region: 714-863
Classification Level Classification E-value
Superfamily TPR-like 0.0000000177
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008387   Gene: ENSPANG00000004621   Transcript: ENSPANT00000009754
Sequence length 870
Comment pep:known_by_projection chromosome:PapAnu2.0:12:58446433:58480427:-1 gene:ENSPANG00000004621 transcript:ENSPANT00000009754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFSPELIDYLEGKISFEEFERRREERKTREKKSLQEKGKLSAEENPDDSEVPSSSGIN
STKSQDKDVNEGETSDGVSKSVHKVFASMLGENEDAPEQPTAGDVFVLEMVLNRETKKMM
KEKRPRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQ
GDMEKSLQFELIAAHLNPSDTEEWVRLAEMSLEQDNIKQAIFCYTKALKYEPTNVRYLWE
RSSLYEQMGDHKMAMDGYRRILNLLSPSDGERFMQLARDMAKSYYEANDVTSAINIIDEA
FSKHQGLVSMEDVNIAAELYISNKQYDKALEVITDFSGIVLSEEGTSEENKAPENVTCTI
PDGVPIDITVKLMVCLVHLNILEPLNPLLTTLVEQNPEDMGDLYLDVAEAFLDVGEYNSA
LPLLSALVCSERYNLAVVWASSCSIILECLKALGYMERAAESYGKVVDLAPLHLDARISL
STLQQQLGRPEKALEALEPMYDPDTLAQDANAAQQELKLLLHRSTLLFSQGKMYGYVDTL
LTMLAMLLKVAMNRAQVCLISSSKSGERHLYLIKVSRDKISDSNDQESANCDAKAIFAVL
TSVLTKDDWWNLLLKAIYSLCDLSRFQEAELLVDSSLEYYSFYDDRQKRKELEYFGLSAA
ILDKNFRKAYNYIRIMVMENVNKPQLWNIFNQVTMHSQDVRHHRFCLRLMLKNPENHALC
VLNGHNAFVSGSFKHALGQYVQAFRTHPDEPLYSLCIGLTFIHMASQKYVLRRHALIVQG
FSFLNRYLSLRGPCQESFYNLGRGLHQLGLIHLAIHYYQKALELPPLVVEGIEVDQLDLR
RDIAYNLSLIYQSSGNTGMAQRLLYTYCSI
Download sequence
Identical sequences ENSPANP00000008387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]