SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008432 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008432
Domain Number 1 Region: 586-995
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.11e-130
Family DNA polymerase I 0.00000384
Further Details:      
 
Domain Number 2 Region: 119-566
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.68e-100
Family DnaQ-like 3'-5' exonuclease 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008432   Gene: ENSPANG00000006810   Transcript: ENSPANT00000028527
Sequence length 1126
Comment pep:known_by_projection chromosome:PapAnu2.0:19:43564578:43601082:1 gene:ENSPANG00000006810 transcript:ENSPANT00000028527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGKRRPGPGPGVPPKRARGSLWDDDDALPPSQFEEDLALMEEMEAEHRLQEQEEEELQS
VLEGVADGQVPPSAIDPRWHRPTPPPLDPQTEPLIFQQLEIDHYVGPAQPVPGGPPLSRG
SVPVLRAFGVTDEGVSVCCHIHGFAPYFYTPAPPGFKPEHLGDLQRELNLAISRDNRGGK
ELTGPAVLAVELCSRESMFGYHGHGPSPFLRITLALPRLVAPARRLLEQGIRVAGLGTPS
FAPYEANVDFEIRFMVDTDIVGCNWLELPAGKYTLRLKKKVQDFPGQGLLPPLTHPCPQT
TQCQLEADVLWSDVVSHPPEGPWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLG
LRWGEQEPFLRLALTLRPCAPILGAKVQSYEKEEDLLQAWSTFIRVMDPDVITGYNIQNF
DLPYLISRAQTLKVETFPFLGRVAGLRSNIRDSSFQSKQTGRRDTKVVSMVGRVQMDMLQ
VLLREYKLRSYTLNAVSFHFLGEQKEDVQHSIITDLQNGNDQTRRRLAVYCLKDAYLPLR
LLERLMVLVNAVEMARVTGVPLSYLLSRGQQVKVVSQLLRQAMHEGLLMPVVRSEGGEDY
TGATVIEPLKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLLRPGAAQKLGLTEDQFIKTP
TGDEFVKTSVRKGLLPQILENLLSARKRAKAELAKETDPLRRQVLDGRQLALKVSANSVY
GFTGAQVGKLPCLEISQSVTGFGRQMIEKTKQLVESKYTVENGYSTSAKVVYGDTDSVMC
RFGVSSVAEAMALGREAADWVSGHFPSPIRLEFEKVYFPYLLISKKRYAGLLFSSRPDTH
DRMDCKGLEAVRRDNCPLVANLVTASLRRLLIDRDPEGAVAHAQDVISDLLCNRIDISQL
VITKELTRAASDYAGKQAHVELAERMRKRDPGSAPSLGDRVPYVIISAAKGVAAYMKSED
PLFVLEHSLPIDTQYYLEQQLAKPLLRIFEPILGEGRAEAVLLRGDHTRCKTVLTGKVGG
LLAFAKRRNCCIGCRTVLNHQGAVCEFCQPRESELYQKEVSHLNALEERFSRLWTQCQRC
QGSLHEDVICTSRDCPIFYMRKKVRKDLEDQEQLLRRFGPPGPEAW
Download sequence
Identical sequences ENSPANP00000008432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]