SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008434 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008434
Domain Number 1 Region: 43-132,168-202
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000163
Family Single strand DNA-binding domain, SSB 0.007
Further Details:      
 
Domain Number 2 Region: 220-309
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000231
Family Cold shock DNA-binding domain-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008434   Gene: ENSPANG00000020381   Transcript: ENSPANT00000007533
Sequence length 856
Comment pep:known_by_projection chromosome:PapAnu2.0:X:95733636:95808850:1 gene:ENSPANG00000020381 transcript:ENSPANT00000007533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGESGQPEAGPSHAGLDWPNPERNRAGVPGGVIRRAGAQGPRSWIQKVLEQIMDSPRQC
VTPSEVVPVTVLAVQRYLLEDEPRDTVPKPPLYCYDVTISDGVYQEKCYLDPSLNSLVYQ
NILKVGIQMRISRVSCLYNEKRIGQGILCIDNVHCGETSDSISLETPFRNRAHQEKPERP
LRGGKSHYLALWNNEDPYGDIWLTDKQPEEHNFSDTKIISLSHLEMTWTNRRNFPALLVR
ILHKSKLRYYGKPDKKMIEPYQTFLEVADSSGTVSVIMWNALCPEWYKSLRVGLVLLLQD
YSVKKSYPFRIQPVPVDPQIKLISTMEICLNLRDPPTNIIIIPEKQVKPEWRLPKLNHRF
TTRSELDDMPENCICDVIGLLVFVGRVQRSKKKENREDFWSYRWIHIADGTSEQPFIVEL
FSTSQPEIFENIYPMAYFVCTQLKVVRNDNQVPKLLYLTTTNESGVFITGGHRGQPYTYD
AKVKNFIQWIRTKSDSGEQKNMVIGGYYPYPPVPETFSKYSSSIKVESLLTAISEVRKEI
EDLQYREQKRIAIQGIITAIKYIPHSSATESASASETLRNANRPSTSQAARVEIQESNGK
RHQDDEPVNSQYFQTTSTNLSLSNKIRILQGPHANPVAVPQPGASVQTKGIKPGMPSIFN
RRANTNASLQGKARKTISDRWESQLWREKKFGLIDHLHYSHVYPESIPRKFMFEHRKFLS
EQYNSQPAKYVPPEGRPPKLDDFKSARSLGHFEVTILGLNHEIAIDVAFLPMYCPEDIRT
SQIDTLLTSMNYSCAYPQDTTGNDRLPGPRAVAGDIIKAATELDRVHIVGILDICNLGNN
KVEVYLHKIYSPENTS
Download sequence
Identical sequences ENSPANP00000008434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]