SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008446 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008446
Domain Number 1 Region: 1334-1646
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.12e-111
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000161
Further Details:      
 
Domain Number 2 Region: 1611-1900
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.34e-98
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000619
Further Details:      
 
Domain Number 3 Region: 318-512
Classification Level Classification E-value
Superfamily Fibronectin type III 3.77e-47
Family Fibronectin type III 0.00054
Further Details:      
 
Domain Number 4 Region: 820-1008
Classification Level Classification E-value
Superfamily Fibronectin type III 1.16e-40
Family Fibronectin type III 0.00088
Further Details:      
 
Domain Number 5 Region: 510-708
Classification Level Classification E-value
Superfamily Fibronectin type III 6.64e-39
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 6 Region: 696-824
Classification Level Classification E-value
Superfamily Fibronectin type III 2.15e-23
Family Fibronectin type III 0.00077
Further Details:      
 
Domain Number 7 Region: 32-134
Classification Level Classification E-value
Superfamily Immunoglobulin 1.17e-18
Family I set domains 0.003
Further Details:      
 
Domain Number 8 Region: 230-323
Classification Level Classification E-value
Superfamily Immunoglobulin 8.71e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 9 Region: 135-227
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-16
Family I set domains 0.028
Further Details:      
 
Domain Number 10 Region: 1017-1100
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000057
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008446   Gene: ENSPANG00000017083   Transcript: ENSPANT00000022687
Sequence length 1908
Comment pep:known_by_projection chromosome:PapAnu2.0:1:45821035:45915175:1 gene:ENSPANG00000017083 transcript:ENSPANT00000022687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEPAPGRTMVPLVPALVMLGLVAGAHGDSKPVFIKVPEDQTGLSGGVASFVCQATGEP
KPRITWMKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSA
KLSVLEEEQLPPGFPSIDMGPQLKVVEKARTATMLCAAGGNPDPEISWFKDFLPVDPATS
NGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSS
QEVMPGGSVNLTCVAVGAPMPYVKWMMGVEELTKEDEMPVGRNVLELSNVVRSANYTCVA
ISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNSEPISYYGIQYRAAGTE
GPFQEVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRV
QARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPPSAWHKHNTDAGLLTTVGSLLP
GITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQAEVESDTRIQLSWLLPPQERI
IMYELVYWVAEDEDQQHKVTFDPTSSYTLEDLKPDTLYRFQLAARSDMGVGVFTPTIEAR
TAQSIPPQPGGKVMCVSTGSTTVRVSWVPPPADSRNGVITQYSVAYEAVDGEDRRRHVVD
GISREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPL
NSTAVHVYWKLPVPSKQHGQIRGYQVTYVRLENGEPRGLPIIQDVMLAEAQWRPEESEDY
ETTISGLTPETTYSITVAAYTTKGDGARSKPKIVTTTGAVPGRPTVMVSTTAMNTALLQW
HPPKELPGELLGYRLQYCRADEARPNTIDFGKDDQHFTVTGLHKGTTYIFRLAARNRAGL
GEEFQKEIRTPEDLPSGFPQNLRVTGLTTSTTELAWDPPVLAERNGRIISYTVVFRDINS
QQELQNVTTDTHFTLSGLKPDTTYDIKVRAWTSKGSGPLSPSIQSRTMPVEQVFAKNFRV
AAAMKTSVLLSWEVPDSYKSAVPFKILYNGQSVEVDGHSMRKLIADLQPNTEYSFVLMNR
GSSAGGLQHLVSIRTAPDLLPHKPLPASAYIEDGRFALSMPHVQDPSLVRWFYIVVVPID
RVGGSMLAPRWSTPEELELDELLEAIEQGGEEQRRRRRQAERLKPYVAAQLDVLPKTFTL
GDKKNYRGFYNRPLSPDLSYQCFVLASLKEPMDQKRYASSPYSDEIVVQVTPAQQQEEPE
MLWVTGPVLAVILIILIVIAILLFKRKRTHSPSSKDEQSIGLKDSLLAHSSDPVEMRRLN
YQTPGMRDHPPIPITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNR
YANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWE
QRTATVVMMTRLEEKSRVKCDQYWPARGTETYGLIQVTLLDTVELATYTVRTFALHKSGS
SEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIV
IDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARNL
YAHIQKLGQVPPGESVTAMELEFKLLASSKAHTSRFISANLPCNKFKNRLVNIMPYELTR
VCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTK
LREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQF
TDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSSAGVGRTGVFITLSIVLERM
RYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHYAT
Download sequence
Identical sequences ENSPANP00000008446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]