SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008466 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008466
Domain Number 1 Region: 385-436,465-665
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 4.94e-37
Family PhyH-like 0.069
Further Details:      
 
Domain Number 2 Region: 60-181
Classification Level Classification E-value
Superfamily ARID-like 6.54e-32
Family ARID domain 0.00074
Further Details:      
 
Domain Number 3 Region: 312-379
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.99e-17
Family PHD domain 0.0013
Further Details:      
 
Domain Number 4 Region: 1180-1258
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000509
Family PHD domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008466   Gene: ENSPANG00000008999   Transcript: ENSPANT00000019282
Sequence length 1557
Comment pep:known_by_projection chromosome:PapAnu2.0:X:49756780:49789458:-1 gene:ENSPANG00000008999 transcript:ENSPANT00000019282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGSDDFLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEV
DNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVV
EEGGYEAICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMYQSGANLVQCNTRP
FDNEEKDKEYKPHSIPLRQSVQPSKFNSYGRRAKRLQPDPEPTEEDIEKNPELKKLQIYG
AGPKMMGLGLMAKDKTLRKKDKEGPECPPTVVVKEELGGDVKVESTSPKTFLESKEELSH
SPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPE
IPKGVWRCPKCVMAECKRPPEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTEL
VEKEFWRLVNSIEEDVTVEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMP
VLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSL
AAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRA
YHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDL
NLAAAVHKEMFIMVQEERRLRKALLEKGITEAEREAFELLPDDERQCIKCKTTCFLSALA
CYDCPDGLVCLSHINDLCKCSSSRQYLRYRYTLDELPAMLHKLKVRAESFDTWANKVRVA
LEVEDGRKRSLEELRALESEARERRFPNSELLQQLKNCLSEAEACVSRALGLVSGQEAGP
HRVAGLQMTLAELRAFLDQMNNLPCAMHQIGDVKGILEQVEAFQAEAREALASLPSSPGL
LQSLLERGRQLGVEVPEAQQLQRQVEQARWLDEVKRTLAPSARRGTLAVMRGLLVAGASV
APSPAVDKAQAELQELLTIAERWEEKAHLCLEARQKHPPATLEAIIREAENIPVHLPNIQ
ALKEALAKARAWIADVDEIQNGDHYPCLDDLEGLVAVGRDLPVGLEELRQLELQVLTAHS
WREKASKTFLKKNSCYTLLEVLCPCADAGSDSTKRSRWMEKELGLYKSDTELLGLSAQDL
RDPGSVIVAFKEGEQKEKEGILQLRRTNSAKPSPLASSTTASSTTSICVCGQVPAGAGAL
QCDLCQDWFHGRCVSVPRLLSSPRPNPTSSLLLAWWEWDTKFLCPLCMRSRRPRLETILA
LLVALQRLPVRLPEGEALQCLTERAISWQGRARQALASEDVTALLGRLTELRQQLQAEPR
PEEPPNYPAAPASDPLREGSGKDMPKVEGLLENGDSVTSPEKVALEEGSDLELLSSLLPQ
LTGPVLELPEATRAPLEELMMEGDLLEVTLDENHSIWQLLQAGQPPDLERIRTLLELEKA
ERHGSRARGRALERRRRRKVDRGGEGDDPAREELEPKRVRSSGPEAEEVQEEEELEEETG
GEGPPAPIPTTGSPSTQENQNGLEPAEGTTSGPLAPFSTLTPRLHLPCPQQPPQQQL
Download sequence
Identical sequences H9G0C5
ENSPANP00000008466 XP_005593688.1.63531 XP_011760021.1.29376 XP_011894718.1.92194 XP_014982964.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]