SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008469 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008469
Domain Number 1 Region: 41-140
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-37
Family Cold shock DNA-binding domain-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008469   Gene: ENSPANG00000021673   Transcript: ENSPANT00000018500
Sequence length 140
Comment pep:known_by_projection chromosome:PapAnu2.0:19:33209713:33211126:1 gene:ENSPANG00000021673 transcript:ENSPANT00000018500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSWSGLLRGLNTSLTCGPALVPQLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLK
GVVLSTFTLKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHNLQEHHIVLVEGGRTQDLP
GVKLTVVRGKYDCGHVQKKK
Download sequence
Identical sequences ENSPANP00000008469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]