SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008484 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000008484
Domain Number - Region: 276-328
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00144
Family PHD domain 0.021
Further Details:      
 
Domain Number - Region: 78-117
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0127
Family PHD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008484   Gene: ENSPANG00000014921   Transcript: ENSPANT00000013004
Sequence length 365
Comment pep:known_by_projection chromosome:PapAnu2.0:X:122668834:122720829:1 gene:ENSPANG00000014921 transcript:ENSPANT00000013004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSSALVSSHSDNE
SLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYHYHCALHDKAQIREKPS
QGIYMVYCRKHKKTAHNSEADLEESFNEHELEPSSPKSKKKSRKGRPRKTNFKGLSEDTR
STSSHGTDEMESSSYRDRSPHRSSPSDTRPKCGFCHVGEEENEARGKLHIFNAKKAAAHY
KCMLFSSGTVQLTTTSRAEFGDFDIKTVLQEIKRGKRMKCTLCSQPGATIGCEIKACVKT
YHYHCGVQDKAKYIENMSRGIYKLYCKNHSGNDERDEEDEERESKSRGKVEIDQQQLTQQ
QLNGN
Download sequence
Identical sequences A0A096N7G4 A0A0D9R5Y5 A0A2I2ZU53 A0A2J8WWX1 A0A2K5J8R7 A0A2K5MUX8 A0A2K5WBH0 A0A2K5ZT51 A0A2K6C7D2 A0A2K6FTM0 A0A2K6PZ13 F6ZMK0 F7HLJ3 K7BPR0 Q5R5Z2 Q8IWS0
ENSNLEP00000002343 9544.ENSMMUP00000010487 9600.ENSPPYP00000023210 9606.ENSP00000329097 9796.ENSECAP00000011381 NP_001015877.1.87134 NP_001015877.1.92137 NP_001127592.1.23681 NP_115834.1.87134 NP_115834.1.92137 XP_003317748.1.37143 XP_003814554.1.60992 XP_004064936.1.27298 XP_004285526.1.21590 XP_004401135.1.74151 XP_004437317.1.5094 XP_005594674.1.63531 XP_006216035.1.17985 XP_006744938.1.47382 XP_006744939.1.47382 XP_006744940.1.47382 XP_007101380.1.24612 XP_007174584.1.59432 XP_007462942.1.90284 XP_007990933.1.81039 XP_008506247.1.77740 XP_009233542.1.23681 XP_010369972.1.97406 XP_010369973.1.97406 XP_010369974.1.97406 XP_010369975.1.97406 XP_010966759.1.22495 XP_010987819.1.51371 XP_011739314.1.29376 XP_011804112.1.43180 XP_011856709.1.47321 XP_011916412.1.92194 XP_012418065.1.74151 XP_012418066.1.74151 XP_012508943.1.63892 XP_014422938.1.101512 XP_014584680.1.31192 XP_014684882.1.49734 XP_014983704.1.72884 XP_019774616.1.83887 XP_020729724.1.74333 ENSP00000329097 ENSP00000359839 ENSMMUP00000010487 ENSP00000329097 ENSP00000359839 ENSMMUP00000010487 ENSPANP00000008484 ENSECAP00000011381 gi|28557677|ref|NP_115834.1| gi|62865858|ref|NP_001015877.1| ENSNLEP00000002343 ENSPPYP00000023210 ENSPPYP00000023210 ENSPPYP00000024461 ENSECAP00000011381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]