SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008499 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008499
Domain Number 1 Region: 9-134
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-41
Family Phosphotyrosine-binding domain (PTB) 0.000000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008499   Gene: ENSPANG00000020396   Transcript: ENSPANT00000015266
Sequence length 508
Comment pep:known_by_projection chromosome:PapAnu2.0:11:64938250:64982124:1 gene:ENSPANG00000020396 transcript:ENSPANT00000015266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVER
NNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESNTPKEEPSSIEDRDP
QILLEPEGVKFVLGPTPVQKQLMEKEKLEQLGRDQVSGSGANNTEWDTGYDSDERRDAPS
VNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVF
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTA
AMSNLQKALPRDDGTSRKTRHNSTDLPM
Download sequence
Identical sequences A0A0D9QW29 A0A2K5MS26 A0A2K5ZU55 G3QRC8 G7N7M1 G7PI07 L9L3H5
ENSGGOP00000005171 ENSCHOP00000002159 ENSCHOP00000002159 ENSGGOP00000005171 ENSPANP00000008499 XP_005571572.1.63531 XP_006146230.2.99106 XP_008002174.1.81039 XP_008002175.1.81039 XP_008002176.1.81039 XP_008002177.1.81039 XP_008002178.1.81039 XP_011725496.1.29376 XP_011725497.1.29376 XP_011725498.1.29376 XP_011725500.1.29376 XP_011725501.1.29376 XP_011725502.1.29376 XP_011725503.1.29376 XP_011831998.1.47321 XP_011831999.1.47321 XP_011832000.1.47321 XP_011832001.1.47321 XP_011832002.1.47321 XP_011832003.1.47321 XP_011832004.1.47321 XP_011832005.1.47321 XP_011905053.1.92194 XP_011905054.1.92194 XP_011905055.1.92194 XP_011905056.1.92194 XP_015007724.1.72884 XP_015007725.1.72884 XP_015007726.1.72884 XP_015286672.1.63531 XP_015286673.1.63531 XP_015286675.1.63531 XP_015286676.1.63531 XP_018894658.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]