SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008504 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008504
Domain Number 1 Region: 295-424
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.62e-43
Family Regulator of G-protein signaling, RGS 0.000022
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.44e-30
Family DEP domain 0.014
Further Details:      
 
Domain Number 3 Region: 222-284
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 3.53e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008504   Gene: ENSPANG00000009367   Transcript: ENSPANT00000017588
Sequence length 451
Comment pep:known_by_projection chromosome:PapAnu2.0:1:208017275:208313018:1 gene:ENSPANG00000009367 transcript:ENSPANT00000017588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMA
AHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELA
DYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGC
VNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTEDELQQQIKYWQ
IQLDRHRLKMSKVADSLLGYTEQYLEYDPFLLPPDPSNPWLSDDTTFWELEASKEPSQQR
VKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIKEVPSRVQEIWQ
EFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQE
LLQAKKKGRNIPIFPCHKNCTPTLRASTNLL
Download sequence
Identical sequences A0A2K5MD10 A0A2K6CTY4 A0A2K6MHP9
ENSPANP00000008504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]