SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008541 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008541
Domain Number 1 Region: 113-238
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.61e-33
Family Synaptotagmin-like (S variant) 0.00018
Further Details:      
 
Domain Number 2 Region: 241-368
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.13e-32
Family Synaptotagmin-like (S variant) 0.0000785
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008541   Gene: ENSPANG00000007903   Transcript: ENSPANT00000000355
Sequence length 402
Comment pep:known_by_projection chromosome:PapAnu2.0:14:1513249:1516011:1 gene:ENSPANG00000007903 transcript:ENSPANT00000000355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHLHGWKPYQQGGKMGHPPDSPSALAPAGTTAIPGLIPDLIAGTPWPRWALIAGALAAG
VLVVSCLLCTACCCCRRHRKKPRDKEAVGLGSARGTTTTHLVQPDVDSLESSPGGAQQWG
RLQLSLEYDFGSQEIRVGLRQAADLRPGGTVDPYARVSVSTQSGHRHETKVHRGTLCPVF
DETCCFHVSQAELPGTTLQVQLFNFKRFSGHEPLGELCLPLGTVDLQHVLEHWYPLGPPA
ATEPEQVGELCFSLRYVPSSGRLTVVVLEARGLHPGLAEPYVKVQLMLNQRKWKKRKTAT
RKGTAAPYFNEAFTFLVPFSQVQNVDLVLAVWDRGLLLRAEPVGKVHLGARASGQPLQHW
ADMLAHARRPIAQWHPLQPAREVDRVLALQPHLRLHLPLPHS
Download sequence
Identical sequences ENSPANP00000008541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]