SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008596 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008596
Domain Number 1 Region: 382-505
Classification Level Classification E-value
Superfamily EF-hand 1.02e-47
Family EF-hand modules in multidomain proteins 0.0000092
Further Details:      
 
Domain Number 2 Region: 508-602
Classification Level Classification E-value
Superfamily EF-hand 1.45e-34
Family EF-hand modules in multidomain proteins 0.0000392
Further Details:      
 
Domain Number 3 Region: 584-670
Classification Level Classification E-value
Superfamily RING/U-box 8.24e-18
Family ZZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 220-341
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-16
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 5 Region: 344-381
Classification Level Classification E-value
Superfamily WW domain 0.0000000000116
Family WW domain 0.00021
Further Details:      
 
Domain Number 6 Region: 79-176
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000157
Family Spectrin repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008596   Gene: ENSPANG00000023953   Transcript: ENSPANT00000001136
Sequence length 957
Comment pep:known_by_projection chromosome:PapAnu2.0:X:91082810:91128133:1 gene:ENSPANG00000023953 transcript:ENSPANT00000001136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPMVMQGCPYTLPRCHDWQAADQFHHSSSLRSTCPHPQVRAAVTSPAPPQDGAGVHCLS
LKLLNGSVGASGPLEPPAMNLCWNEIKKKSHNLRARLEAFSDHSGKLQLPLQEIIDWLSQ
KDEELSAQLPLQGDVALVQQEKETHAAFMEEVKSRGPYIYSVLESAQAFLSQHPFEELEE
PHSESKDTSPKQRIQNLSRFVWKQATVASELWEKLTARCVDQHRHIERTLEQLLEIQGAM
EELSTTLSQAEGVRATWEPIGDLFIDSLPEHIQAIKLFKEEFSPMKDGVKLVNDLAHQLA
ISDVHLSMENSHALEQINVRWKQLQASVSERLKQLQDAHRDFGPGSQHFLSSSVQVPWER
AISPNKVPYYINHQAQTTCWDHPKMTELYQTLADLNNIKFSAYRTAMKLRRVQKALRLDL
VTLTTALEIFNEHDLQASEHVMDVVEVIHCLTALYERLEEERGILVNVPLCVDMSLNWLL
NVFDSGRSGKMRALSFKTGIACLCGTEVKEKLQYLFSQVANSGSQCDQRHLGVLLHEAIQ
VPRQLGEVAAFGGSNVEPSVRSCFRFSTGKPVIEASQFLEWVNLEPQSMVWLAVLHRVTI
AEQVKHQTKCSICRQCPIKGFRYRSLKQFNVDICQTCFLTGRASKGNKLHYPIMEYYTPT
TSSENMRDFATTLKNKFRSKHYFSKHPQRGYLPVQSVLEADYSETPASSPMLSHADTHSR
IEHFASRLAEMESQNCSFFNDSLSPDDSIDEDQYLLRHSSPITDREPAFGQQAPCSVATE
SKGELQKILAHLEDENRILQGELRRLKWQHEEAAEAPTLADGSTEAAPDHRNEELLAEAR
ILRQHKSRLETRMQILEDHNKQLESQLQRLRELLLQPPTESDGSGSAGSSLASSPQQSEG
SHPREKGQTTPDTEAADDVGSKSQDVSLCLEDIMEKLRHAFPSVRSSDVTANTLLAS
Download sequence
Identical sequences A0A096N7Q1
ENSPANP00000008596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]