SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008640 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008640
Domain Number 1 Region: 21-216
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000949
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008640
Domain Number - Region: 490-573
Classification Level Classification E-value
Superfamily TPR-like 0.000474
Family Tetratricopeptide repeat (TPR) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008640   Gene: ENSPANG00000010015   Transcript: ENSPANT00000014906
Sequence length 973
Comment pep:known_by_projection chromosome:PapAnu2.0:11:111206837:111290492:-1 gene:ENSPANG00000010015 transcript:ENSPANT00000014906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRGHVQDPNDRRLRPIYDYLDNGNNKMAIQQADKLLKKHKDLHCAKVLKAIGLQRTGK
QEEAFTLAQEVAALEPTDDNSLQALTILYREMHRPELVTKLYEAAVKKVPNSEEYHSHLF
MAYARVGEYKKMQQAGMALYKIVPKNPYYFWSVMSLIMQSISAQDENLSKTMFLPLAERM
VEKMVKEDKIEAEAEVELYYMILERLGKYQEALDVIRGKLGEKLTSEIQSRENKCMAMYK
KLSRWPECNALSRRLLLKNSDDWQFYLTYFDSVFRLIEEAWTPPAEGEHSLEGEVHYSAE
EAVKFIEDRITEESKSSRHLRGPHLAKLELIRRLRSQGCNDEYKLGDPEELMFQYFKKFG
DKPCCFTDLKVFVDLLPATQCTKFINQLLGVVPLSTPTEDKLALPADIRALQQHLCVVQL
TRLLGLYHTMDKNQKLSVVRELMLRYQHGLEFGKTCLKTELQFSDYYCLLAVHVLIDVWR
ETGDETAVWQALTLLEEGLTHSPSNAQFKLLLVRIYCMLGAFEPVVDLYSSLDAKHIQHD
TIGYLLTRYAESLGQYAAASQSCNFALRFFHSNQKDTSEYIIQAYKYGAFEKIPEFIAFR
NRLNNSLHFAQVRTERMLLDLLLEANISTSLAESIKSMNLRPEEDDIPWEDLRDNRDLNV
FFSWDPKDRDVSEEHKKLSLEEETLWLRIRSLTLRLISGLPSLNHPVEPKNSEKTAENGV
SSRIDILRLLLQQLEAALETGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLV
SDIYELDTSGLVEDTMEIQERIENSFKSLLNQLKDVFSKCKGDLLEVKDGNLKTHPTLLE
NLVFFVETISVILWVSSYCESVLRPYKLNLLRYRQSHKDTFIILPPVFTSFQDYVTGLQI
LISNVVDHIKGLETYLIALKLEELILEDTSLSPEERKFSKTVQGKVQSSYLHSLLEMGEL
LKKRLETTKKLKI
Download sequence
Identical sequences ENSPANP00000008640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]