SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008654 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008654
Domain Number 1 Region: 98-223
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000216
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008654
Domain Number - Region: 436-453
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 0.0837
Family Chlorophyll a-b binding protein 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008654   Gene: ENSPANG00000004465   Transcript: ENSPANT00000017736
Sequence length 653
Comment pep:known_by_projection chromosome:PapAnu2.0:19:16025408:16053965:1 gene:ENSPANG00000004465 transcript:ENSPANT00000017736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPATQVPLNRGTQAVVVGRGREAPGDGSSMGGRPSSPLDKQQQQHLRGQVDILMRNFLPC
YRGQLAASILRQISRELGPQEPAGSQLLRSKKLPRVREHRGPLTQLRGHPPRWQPIFCVL
RGDGRLEWFSHKEEYENGGHPLGSTALTGYTLLTSQREYLRLLDALCPDSLGDHTQEEPD
SLLEVPVSFPLFLQHPFRQHLCFSAATREAQHAWRLALQGGIRLRGTVLQRSQAPAARAF
LDAVRLYRQHQGHFGDDDVTLGSDAEVLTAVLMREQLPALRAQTLPGLRGSGRARAWAWT
ELLDAVHAAVLAGASAGLRAFQPEKDELLASLEKTIRPDVDQLLRQRARVAGRLRSETRG
GGASAGDRRGLEAEAAGVEALSRAKEASLQAVRTLLAQGMDRLSRRLRQSPSGTRLRREV
YSFGEMPWDLALMQTCYREAERSHGRLGQLAAPFGFLGMQSLVFGAQDLAQQLIADAVAT
FLQLADQCLTMALNCDQAAQRLERVRGRVLKKFESDSGLAQRRFIRGWGLCIFLPFVLSQ
LEPSCKKELPEFEGDVLAMGSQALTSEGIYEDVIRGCLLQRIDRELKKTLGANDVSCTLD
GCLEVPWEQEGAGPRKTSDLQLDVRDCRWVPPGSGAQIQPLCPPPSCRGTFTP
Download sequence
Identical sequences ENSPANP00000008654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]