SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008655 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008655
Domain Number 1 Region: 392-600
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.31e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.0000802
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008655
Domain Number - Region: 263-382
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00108
Family PLC-like (P variant) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008655   Gene: ENSPANG00000010522   Transcript: ENSPANT00000004517
Sequence length 733
Comment pep:known_by_projection chromosome:PapAnu2.0:19:13834710:13841666:1 gene:ENSPANG00000010522 transcript:ENSPANT00000004517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPLLRKTFSRLRGREKLPRKKSDAKERGRPAQRPEPSPPEPEPQAPEGSQAGAEGPPS
PEASRSPARGAYLQSLEPSSRRWVLGGAKPAEDTSLGPGVPGSGEPAGEIWYNPIPEEDP
RPPAPEPPGPQPGSAEPEGLASQGAAPASPPAKASRTKSPGPARRLSIKMKKLPELRRRL
SLRGPRAGRERERAAPAGSVISRYHLDSSVGGPGRAAGPGGTRSPRAGYLSDGDSPERPA
GPPSPTSFRPYEVGPTARAPPAALWGRLSLHLYGLGGLRPAPGATPRDLCCLLQVDGEAR
ARTGPLRGGPDFLRLDHTFHLELEAARLLRALVLAWDPGVRRHRPCAQGTVLLPTVFRGC
QAQQLAVRLEPQGLLYAKLTLSEQQEAPATAEPRVFGLPLPLLVERERPPGQVPLIIQKC
VGQIERRGLRVVGLYRLCGSAAVKKELRDAFERDSAAVCLSEDLYPDINVITGILKDYLR
ELPTPLITQPLYQVVLEAMARDPPNRASPTTEGTRGLLSCLPDVERATLTLLLDHLRLVS
SFHAYNRMTPQNLAVCFGPVLLPARQAPTRPRARSSGPGLASAVDFKRHIEVLHYLLQSW
PDPRLPGEAPDVAPYLRPKRQPPLHLPLADPEVVTRPRGRGGPESPPSNRYAGDWSVCGR
DFLSCGRDFLSGPDYDHVTGSDSEDEDVGEPRVTADFEDDFDAPFNPHLNLKDFDALILD
LERELSKQINVCL
Download sequence
Identical sequences A0A0A0MW83
ENSPANP00000008655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]