SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008668 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008668
Domain Number 1 Region: 525-553,660-736
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000022
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008668   Gene: ENSPANG00000011608   Transcript: ENSPANT00000011269
Sequence length 926
Comment pep:known_by_projection chromosome:PapAnu2.0:1:157974266:157995255:1 gene:ENSPANG00000011608 transcript:ENSPANT00000011269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNTFRCSSAKIKAVVFGLLPVLS
WLPKYKIKDYIVPDLLGGLSGGSIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGV
HQMVPGTFAVISILVGNICLQLAPESKFQVFNNATNESYVDTAAMEAERLHVSATLACLT
AIIQIGLGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTIPSYAGPGSIVFT
FIDICKNLPHTNIASLIFALISGAFLVLVKELNARYMHKIRFPIPTEMIVVVVATAISGG
CKMPKKYHMQIVGEIQRGFPTPVSPVVSQWKDMIGTAFSLAIVGYVINLAMGRTLANKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGTYLYPLPKSVLGALIAVNLKNSLKQLTDPYYLWRKSKLDCCIWVVSFLSSFFLSLPY
GVAVGVAFSVLVVVFQTQFRNGYALAQVMDTDIYVNPKTYNRAQDIQGIKIITYCSPLYF
ANSEIFRQKVIAKTGMDPQKVLLAKQKYLKKQEKRRMRPTQQRRSLFMKTKTVSLQELQQ
DFENASPTDPNNNQTQANGTSVSYITFSPDSSSAAQSEPPASAEAPGEPSDTLASVPPFV
TFHTLILDMSGVSFVDLMGIKTLAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGS
LECKHVFPSIHDAVLFAQANARDVTPGHSFQGAPGDPELSLYDSEEDIPSYWDLEQEMFG
SMFHTETLTALESLSAAAGCYPSRNESLVSPVFTRQALATMDKPPARSTPPTSALSLAAE
GHLDFQLLQVSQKQKDKYNCAGLLYKLQKVSQSPHGSVSDGVRLSQDIGINLVRTLACLP
QLPQLCLWQLCTRGPCALHTQESRPW
Download sequence
Identical sequences ENSPANP00000008668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]