SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008669 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008669
Domain Number 1 Region: 113-185
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.8e-16
Family Complement control module/SCR domain 0.00035
Further Details:      
 
Domain Number 2 Region: 174-237
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000113
Family Complement control module/SCR domain 0.00024
Further Details:      
 
Domain Number 3 Region: 425-487
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000128
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 235-299
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 5 Region: 482-540
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000862
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 6 Region: 50-117
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000229
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 7 Region: 299-368
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000256
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 8 Region: 386-428
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000236
Family Complement control module/SCR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008669   Gene: ENSPANG00000017949   Transcript: ENSPANT00000017692
Sequence length 596
Comment pep:known_by_projection chromosome:PapAnu2.0:1:156771945:156809627:-1 gene:ENSPANG00000017949 transcript:ENSPANT00000017692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPSRTPSGALHRKGKMAAWPFSRLWKVSDPILFQMTLVAALLPAILGNCDPPPTLSFAA
PVNITTLTETHFETGTTLKYTCRPGYARSHSDQMLTCNSDGQWTYTTFCTHRRCSNPGDL
PNGHVEIKTDLLFGSEIEFSCSEGFVLIGSTSSHCEVQDRGVGWSHPLPQCEIVKCEPPP
DIRNGRHSGEEDFYTYGFSVTYSCDSRFSLLGHASISCTVENKTTGVWRPSPPTCEKITC
HKPDVSGEIVSGFGPIYNYRDAIVFKCQKGFALTGSSVIRCGADSKWDPSPPACEPSSCT
NLPDIPHASWETYPRPKKEDVYVVGTILRYRCHPGYKPTTDAPMTLICQKNLRWTPYQGC
EALCCPEPKLDSAQITQHRKNRPANHCVYFYGDEISFSCHGIRRSATCQADGTWSPRTPS
CGDNCHFPPKIAHGHYKQASVYTFFKEEIIYECDKGYVLVGQATLSCSNSHWSAPAPRCK
ALCLKPELVNGRLSVDKNQYVEPETVTIQCDSGYGMVGPKSITCSENRTWYPEVPRCEWE
TPEGCEQVLAGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDRARQSTLDKEL
Download sequence
Identical sequences ENSPANP00000008669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]