SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008677 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008677
Domain Number 1 Region: 2-222
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-59
Family Protein kinases, catalytic subunit 0.0000618
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008677
Domain Number - Region: 235-306
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0353
Family Regulator of G-protein signaling, RGS 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008677   Gene: ENSPANG00000013610   Transcript: ENSPANT00000007448
Sequence length 860
Comment pep:novel chromosome:PapAnu2.0:1:215689021:215746928:-1 gene:ENSPANG00000013610 transcript:ENSPANT00000007448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRHPNIIELRGVCLQQPHLCLVLEFARGGALNRALAAANAAPDPRAPGPRRARRIPPHV
LVNWAVQIARGMLYLHEEAFVPILHRDLKSSNILLLEKIEHDDICNKTLKITDFGLAREW
HRTTKMSAAGTYAWMAPEVIKSSLFSKGSDIWSYGVLLWELLTGEVPYRGIDGLAVAYGV
AVNKLTLPIPSTCPEPFAKLMKECWEQDPHIRPSFALILEQLTAIEGAVMTEMPQESFHS
MQDDWKLEIQQMFDELRTKEKELRSREEELTRAALQQKSQEELLKRREQQLAEREIDVLE
RELNILIFQLNQEKPKVKKRKGKFKRSRLKLKDGHRISLPSDFQHKITVQASPNLDKRRS
LNSSSSSPPSSPTMMPRLRAIQLTSDESNKTWGRNTVFRQEEFEDVKRNFKKKGCTWGPN
SIQVKERADCKERIRPLSDGNSPWSTILIKNQKPMPLASLFVDQSGSCEEPKLSPDGLEH
RKPKQIKLPSQAYIDLPLGKDAQRENPAEAESWEEAASANAATVSTEVTPMNNLSRSPQR
KKTESALYGCTVLLASVALGLDLRELHKAQAAEEPLPKEEKKKREGIFQRASKSRRSASP
PTRLPPTGREASSPLSLPRTSALGILSTPSLSTKCLLQIDSEDPLTGGTPVTCDSEMLTP
DFSPTAPGSGREPALMPRLDTARSVSGNLPSSFLEQTCGNVPYWASSKDRPSHHRRTMSD
GNPTPTGAAIISITGASALPLCPSPAPHSHLPREVSPKKHSTVHIVPQPRPASLRSRSDP
PQAHPQAAVSQLAQAACVVGRPGPHPTQFLATKERTKSHVPSLLDADVEGQSRDYTVPLC
RMRSKTSRPSIYELEKEFLS
Download sequence
Identical sequences A0A096N7W1
ENSPANP00000008677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]