SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008697 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008697
Domain Number 1 Region: 374-438
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.59e-18
Family LIM domain 0.013
Further Details:      
 
Domain Number 2 Region: 7-85
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000101
Family PDZ domain 0.002
Further Details:      
 
Domain Number 3 Region: 434-459
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000597
Family LIM domain 0.036
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008697
Domain Number - Region: 350-378
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0136
Family LIM domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008697   Gene: ENSPANG00000009298   Transcript: ENSPANT00000011256
Sequence length 464
Comment pep:known_by_projection chromosome:PapAnu2.0:6:170851777:170865520:-1 gene:ENSPANG00000009298 transcript:ENSPANT00000011256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRVSLGGNAYRVHVEAGIGIEARDGVHFLW
VEGVSPQPMSQPCGHELKLGLSRAQPVQSKPQKASVPAADPPRYTFAPSVSLNKTARPFG
APPPADSALQQNGQPLRPLVPDASKQRLMENTEDWRPRPGTGQSRSFRILAHLTGTEFMQ
DPDEEHLKKSSQVPRTEAPAPASSTPQEPWPGPTTPSPTSRPPWAVDPAFAERYAPDKTS
TVLTRHSQPATPTPLQNRTSIVQAAAGGVPGGGSNNGKTPVCHQCHKVIRWVSCSRPTLA
FPSCSPTPPVCPPILPQLRLGGIKEKGGTVLGPAQLQGRFGPSCRLEAPCCPLPAPEEIM
HALKMTWHVHCFTCAACKTPIRNRAFYMEEGVPYCERDYEKMFGTKCHGCDFKIDAGDRF
LEALGFSWHDTCFVCAICQINLEGKTFYSKKDRPLCKSHAFSHV
Download sequence
Identical sequences ENSPANP00000008697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]