SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008729 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008729
Domain Number 1 Region: 6-416
Classification Level Classification E-value
Superfamily Ras GEF 1.22e-101
Family Ras GEF 0.00026
Further Details:      
 
Domain Number 2 Region: 488-548
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.83e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00099
Further Details:      
 
Domain Number 3 Region: 422-485
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000248
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008729   Gene: ENSPANG00000007703   Transcript: ENSPANT00000000526
Sequence length 694
Comment pep:known_by_projection chromosome:PapAnu2.0:13:32513902:32563947:1 gene:ENSPANG00000007703 transcript:ENSPANT00000000526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSGLGKAATLDELLHTCIEMFDEYNGELNNSYLPRIVLLMHRWYLSSTELAEKLLCIW
FTYRNATGESCNEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVS
LIDISSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDY
QSYVIHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLK
NFNTLMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDG
FKIPILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHLEPNMDL
INLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWALGVMPKPDPTV
INKHIRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMA
YFLRAKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQC
KDLLVLACRRFARAPSLSSGHGSLPGSPSLPPAQDEVFEFPGVTAGHRDLDSRAITLVTG
SSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMRSKFHDKAAKDKGFAKWENE
KPRVHAGVDVVDRGTEFELDQDEGEETRQDGEDG
Download sequence
Identical sequences ENSPANP00000008729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]