SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008758 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008758
Domain Number 1 Region: 18-349
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.41e-120
Family Calpain large subunit, catalytic domain (domain II) 0.0000000146
Further Details:      
 
Domain Number 2 Region: 357-518
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 4.58e-42
Family Calpain large subunit, middle domain (domain III) 0.0000305
Further Details:      
 
Domain Number 3 Region: 537-688
Classification Level Classification E-value
Superfamily EF-hand 9.69e-20
Family Penta-EF-hand proteins 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008758   Gene: ENSPANG00000009955   Transcript: ENSPANT00000009117
Sequence length 710
Comment pep:known_by_projection chromosome:PapAnu2.0:19:33005591:33019507:-1 gene:ENSPANG00000009955 transcript:ENSPANT00000009117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACSSGRVTIQLVDEEAGVGAGGLQLFRGQSYEAIRAACLDSGILFRDPYFPAGPDALGY
DQLGPDSEKAKDVKWMRPHEFCAEPKFICEDMSRTDVCQGSLGNCWFLAAAASLTLYPRL
LRRVVPPGQDFQHGYAGVFHFQLWQFGRWVDVVVDDRLPVREGKLMFVRSEQRNEFWAPL
LEKAYAKLHGSYEVMRGGHMNEAFVDFTGGVGEVLYLRQNSMGLFSALRHALAKESLVGA
TALFPSSDRGECRTEEGLVKGHAYSVTGTHKVFLGFTKVRLLRLRNPWGRVEWTGAWSDS
CPRWDALPTECRDALLVKKEDGEFWMELRDFLLHFDTVQICSLSPEVLGPSPEWGGWHVH
TFQGRWVRGFNSGGSQPSAETFWTNPQFRLTLLEPDEEEDEDEEGPTLKCTVLLSLTQRN
RRRLRAKGLTYLTVGFHVFQIPEELLGLWDSPRSRALLPRLLRADRSPLSARRDVSRRCR
LRPGHYLVVPSTAHAGDEADFTLRVFSERRHTAVEIDDVISADLQALQGPYLPLELDLEQ
LFKELAGEEEELNASQLQALLSIALEPDPHGPQSGGQNAGKCCGEIDLNQMPPPPTQHGQ
SLALHHFQQLWGHLLEWQAIFHKFDEDASGTMNSYELRLALNAAGFHLNNQLTQALTSRY
RDSRLRVDFERFVSCVAQLTCIFLVLRKSETWREGLGGSPAVGWRWRPLL
Download sequence
Identical sequences ENSPANP00000008758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]