SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008763 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008763
Domain Number 1 Region: 114-305
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-40
Family Pleckstrin-homology domain (PH domain) 0.0088
Further Details:      
 
Domain Number 2 Region: 4-91
Classification Level Classification E-value
Superfamily EF-hand 0.000000132
Family Calmodulin-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008763   Gene: ENSPANG00000019080   Transcript: ENSPANT00000012036
Sequence length 579
Comment pep:known_by_projection chromosome:PapAnu2.0:14:55226687:55306533:-1 gene:ENSPANG00000019080 transcript:ENSPANT00000012036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLKDELLKAIWHAFTALDQDHSGKVSKSQLKVLSHNLCTVLKVPHDPVALEEHFRDDD
EGPVSNQGYMPYLNRFILEKVQDNFDKIEFNRMCWTLCVKKNLTKNPLLITEEDAFKVWV
IFNFLSEDKYPLIIVSEEIEYLLKKLTEAMGGGWQQEQFEHYKINFDDSKNGLSAWELIE
LIGNGQFSKGMDRQTVSMAINEVFNELILDVLKQGYMMKKGHRRKNWTERWFVLKPNIIS
YYVSEDLKDKKGDILLDENCCVESLPDKDGKKCLFLVKCFDKTFEISASDKKKKQEWIQA
IHSTIHLLKLGSPPPHKEARQRRKELRKKQLAEQEELERQMKELQVANESKQQELEAVRK
KLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVR
ELEDMYLKLQEALEDERQARQDEETVRKLQARLLEEESSKRAELEKWHLEQQQAIQTTEA
EKQELENQRVLKEQALQEAMEQLEQLELERKQALEQYEEVKKKLEMATHKTKSWKDKVAH
HEGLIRLIEPGSKNPHLITNWGPAAFTEAENWKEKKTTE
Download sequence
Identical sequences ENSPANP00000008763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]