SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008797 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008797
Domain Number 1 Region: 155-345
Classification Level Classification E-value
Superfamily E set domains 1.49e-64
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000191
Further Details:      
 
Domain Number 2 Region: 49-169
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-18
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008797   Gene: ENSPANG00000021162   Transcript: ENSPANT00000023090
Sequence length 375
Comment pep:known_by_projection chromosome:PapAnu2.0:3:8265476:8266603:-1 gene:ENSPANG00000021162 transcript:ENSPANT00000023090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAIHISMSSTPLVKHTAGAGLKANRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVID
MKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPGEPISNHTPCIMKVDSLTGAFLF
SLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKF
SHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVD
SSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTSY
IPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQKLEEKYRQEDQ
RERELRTLLLQQSNV
Download sequence
Identical sequences A0A096N871 A0A2K5XUX7 A0A2K6AU96 F7CZK1 G7P102
ENSMMUP00000022070 9544.ENSMMUP00000022070 ENSPANP00000008797 ENSMMUP00000022070 XP_011724363.1.29376 XP_011724365.1.29376 XP_011724366.1.29376 XP_011724367.1.29376 XP_011724368.1.29376 XP_011724369.1.29376 XP_011724370.1.29376 XP_011839531.1.47321 XP_011839532.1.47321 XP_011839533.1.47321 XP_011839534.1.47321 XP_011839535.1.47321 XP_011839536.1.47321 XP_011839537.1.47321 XP_011839538.1.47321 XP_011839539.1.47321 XP_011839540.1.47321 XP_011839542.1.47321 XP_011839543.1.47321 XP_011839544.1.47321 XP_011839545.1.47321 XP_011892629.1.92194 XP_011892630.1.92194 XP_011892631.1.92194 XP_011892632.1.92194 XP_011892633.1.92194 XP_011892634.1.92194 XP_011892635.1.92194 XP_011892637.1.92194 XP_011892638.1.92194 XP_011892639.1.92194 XP_011892640.1.92194 XP_014988386.1.72884 XP_014988387.1.72884 XP_014988388.1.72884 XP_014988389.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]