SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008857 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008857
Domain Number 1 Region: 403-695
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.85e-80
Family Eukaryotic proteases 0.00017
Further Details:      
 
Domain Number 2 Region: 24-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-33
Family Spermadhesin, CUB domain 0.0000146
Further Details:      
 
Domain Number 3 Region: 184-296
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-32
Family Spermadhesin, CUB domain 0.0000266
Further Details:      
 
Domain Number 4 Region: 300-370
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000132
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 134-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family EGF-type module 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008857   Gene: ENSPANG00000014789   Transcript: ENSPANT00000027137
Sequence length 699
Comment pep:known_by_projection chromosome:PapAnu2.0:2:177296165:177371876:-1 gene:ENSPANG00000014789 transcript:ENSPANT00000027137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWLLLYHALCFSLSKASAHIVELNDMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKL
YFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRS
DFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRT
CRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEV
PCPYDYIKIKVGPKVLGPFCGEKAPEPINTQSHSVLILFHSDNSGENRGWRLSYRAAGNE
CPELQPPVHGKIEPSQAKYSFKDQVLISCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIP
TCKIVDCRAPGELEHGLVTFSTRNNLTTYKSEIRYSCQEPYYKMLNNITGIYTCSAQGVW
MNKVLGRSLPTCLPVCGLPKFSRKLMARIFNGRPAQQGTTPWIAMLSHLNGQPFCGGSLL
GSSWIVTAAHCLHQSLDPEDPTLRNSDLLSPSDFKIILGKHWRLRSDENEQHLRVKHITL
HPQYDPNTFENDVALVELLESPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPET
LMEIEIPIVDHGTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLNRERGQW
YLVGTVSWGDGCGKKDRYGVYSYIHHNKDWIQRVTRLRN
Download sequence
Identical sequences A0A096N8D0
ENSPANP00000008857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]