SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008891 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008891
Domain Number 1 Region: 877-1057
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-38
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 2 Region: 692-873
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-37
Family Laminin G-like module 0.0036
Further Details:      
 
Domain Number 3 Region: 476-680
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.52e-35
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 289-457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.24e-33
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 5 Region: 25-184
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.11e-30
Family Laminin G-like module 0.005
Further Details:      
 
Domain Number 6 Region: 1090-1230,1259-1301
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.81e-29
Family Laminin G-like module 0.000000908
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008891
Domain Number - Region: 211-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000285
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008891   Gene: ENSPANG00000004471   Transcript: ENSPANT00000018202
Sequence length 1503
Comment pep:novel chromosome:PapAnu2.0:14:9369597:9488311:1 gene:ENSPANG00000004471 transcript:ENSPANT00000018202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGSRWRLPPPPPLLLLLLLALAARADGLEFGGGPGQWARYARWAGAASSGELSFSLRT
NATRALLLYLDDGGDCDFLELLLVDGRLRLRFTLSCAEPATLQLDTPVADDRWHMVLLTR
DARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLL
ANLKLGERPPALLGSQGLRGATADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGK
FCSEEEHPMEGPAHLTLNSEVGSLLFSEGGAGRGGAGDVHQPTKGKEEFVATFKGNEFFC
YDLSHNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEA
LVEPVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDF
FYIGGSPNTADLPGSPVSNNFMGCLKDVVYKNNDFKLELSRLAKEGDPKMKLQGDLSFRC
EDVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGGGTGSHS
SAQRADYFAMELLDGHLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKGSISVNS
RSTPFLATGDSEILDLESELYLGGLPEGGRVDLPLPPEVWTAALRAGYVGCVRDLFIDGR
SRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGICREGWNRFVCDCIGTGFLGRVC
EREATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADTLRLELD
GGQMKLTVNLGKGPETLFAGHKLNDNEWHTVRVVRRGKSLQLSVDNVTVEGQMAGAHTRL
EFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGDITYCELNARFGLRAI
VADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSGNGNDFIVIELVKGYI
HYVFDLGNGPSLMKGNSDKPVNDNQWHNVVVSRDPGNVHTLKIDSRTVTQHSNGARNLDL
KGELYIGGLSKSMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIADALHRIGQVERGCDG
PSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGTTYIFGKGGALITYTWPPN
DRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTDDITIDE
PNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERLAIARQRIPYRLGRVV
DEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDPNVRTEG
HLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMATTTTRRGRSPTLRDSTTQNTDD
LLVASAECPSDDEDLEECEPSTANPTGPGERGPPGAVEVIRESSSTTGMVVGIVAAAALC
ILILLYAMYKYRNRDEGSYQVDQSRNYISNSAQSNGAVVKEKAPTAPKTPSKAKKNKDKE
YYV
Download sequence
Identical sequences ENSPANP00000008891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]