SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008905 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008905
Domain Number 1 Region: 352-408,437-641
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.95e-40
Family PhyH-like 0.079
Further Details:      
 
Domain Number 2 Region: 65-179
Classification Level Classification E-value
Superfamily ARID-like 1.83e-30
Family ARID domain 0.0007
Further Details:      
 
Domain Number 3 Region: 294-352
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.13e-16
Family PHD domain 0.002
Further Details:      
 
Domain Number 4 Region: 1124-1207
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000288
Family PHD domain 0.008
Further Details:      
 
Domain Number 5 Region: 1575-1642
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000159
Family PHD domain 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008905
Domain Number - Region: 819-918
Classification Level Classification E-value
Superfamily YacF-like 0.0445
Family YacF-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008905   Gene: ENSPANG00000000962   Transcript: ENSPANT00000028378
Sequence length 1663
Comment pep:known_by_projection chromosome:PapAnu2.0:11:304622:400455:-1 gene:ENSPANG00000000962 transcript:ENSPANT00000028378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGVGPGGYASEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPP
FACEVKSFRFTPRVQRLNELEAMTRVRLDFLDQLAKFWELQGSTLKIPVVERKILDLYAL
SKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEILSTDTQTSPEPGTRMNTLPKRTRRVKSQSESGDVNRNTELKKLQ
IFGAGPKVVGLAMGTKDKEGKIMKRNKAGYVLTISELNEMLQSQILITMYLEQVDLYVCM
FCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQA
VREYTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKD
FGSGFPVKDGRRKMLPEEEEYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCF
SSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLV
TIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQ
CVNHYRRLRRHCVFSHEELIFKMAADPECLDVGLAAMVCKELTLMTEEETRLRESVVQMG
VLMSEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLR
YRYPLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPE
NDLFRKLRDAVKEAETCASVAQLLLSKKQKHRQSPDSGRTRTKLTVEELKAFVQQLFSLP
CVISQARQVKNLLDDVEEFHERAQEAMMDETPDSSKLQMLIDMGSSLYVELPELPRLKQE
LQQARWLDEVRLTLSDPQQVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLTVSERWEE
KAKVCLQARPRHSVASLESIVNEAKNIPAFLPNVLSLKEALQKAREWTAKVEAIQSGSNY
AYLEQLESLSAKGRPIPVRLEALPQVESQVAAARAWRERTGRTFLKKNSSHTLLQVLSPR
TDIGVYGSDLDLEPLSDLEEGLEETRDTAVVVAVFKEREQKEIEAMHSLRAANLAKMTMV
DRIEEVKFCICRKTASGFMLQCELCKDWFHNSCVPLPKSSSQKKGSNWQAKEVKFLCPLC
MRSRRPRLETILSLLVSLQKLPVRLPEGEALQCLTERAMSWQDRARQALATDELSSALAK
LSVLSQRMVEQAAREKTEKIISAELQKAAANPDLQGHLPSFQQSAFNRVVSSVSSSPRQT
MDYDDEETDSDEDIRETYGYDMKDTASVKSSSSLEPNLFCDEEIPIKSEEVVTHMWTAPS
FCAEHAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPGAKAQLEELMMVGDLL
EVSLDETQHIWRILQATHPPSEDRFLHIMEDDSMEEKPLKVKGKDSSEKKRKRKLEKVEQ
LFGEGKQKSKELKKMDKPKKKKLKLSADKSKELNKLAKKLAAAAKVELVKESTEKKREKK
VLDIPSKYDWSGAEESDDENAVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEM
AENEDYICINCAKKQGPVSPGPAPPPSFIMSYKLPVEDLKETS
Download sequence
Identical sequences ENSPANP00000008905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]