SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008911 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008911
Domain Number 1 Region: 517-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000223
Family Laminin-type module 0.0002
Further Details:      
 
Domain Number 2 Region: 28-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 3 Region: 462-519
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Laminin-type module 0.00095
Further Details:      
 
Domain Number 4 Region: 142-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000014
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 5 Region: 84-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000197
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008911
Domain Number - Region: 379-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000698
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 921-1171
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008911   Gene: ENSPANG00000004870   Transcript: ENSPANT00000005523
Sequence length 1194
Comment pep:known_by_projection chromosome:PapAnu2.0:1:181045974:181104605:-1 gene:ENSPANG00000004870 transcript:ENSPANT00000005523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALWLGCCLCFSLLLPAARATSRREVCDCNGKSRQCIFDQELYRQTGNGFRCLNCNDNT
DGIHCERCKDGFYRHRERDRCLPCNCNSKGSLSARCDNSGRCSCKPGVTGARCDRCLPGF
HMLTDAGCTQDQRLLDSKCDCDPAGIAGPCDAGRCVCKPAVTGERCDRCRSGYYNLDRGN
PEGCTQCFCYGHSASCRSSADYSVHKITSTFNQDVDGWKAVQRNGSPAKLQWSQRHQDVF
SSARRPDPVYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRHPSAHDVILEGAGLRITAPL
MPLGKTLPCGLTKTYTLRLNEHPSSNWSPQLSYFEYRRLLRNLTALRIRATYGEYSTGYI
DNVTLISARPVSGAPAPWVEQCICPVGYKGQFCQDCASGYKRDSAKLGPFGTCIPCNCQG
GGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVV
CNNCPPGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSSSGNCDRLTGRCLK
CIHNTAGIYCDQCKAGYFGDPLAPNPAEKCRACNCNPMGSEPVECRSDGTCVCKPGFGGP
SCEHGAFSCPACYNQVKIQMDQFMQQLQRMEALISKAQGGDGAVLDTELEGRMQQAEQAL
RDILRDAQISEGASRSLGLQLAKVRSQENSYRSRLDDLKMTVERVRALGSQYQNQVRDTH
RLITQMQLSLAESEASLGNTNIPASDHYVGPNGFKSLAQEATRLAESHVESASNMEQLTK
ETEDYSKQALSLVHKALREGGGSGSGSLDGAVVQGVVEKLEKTKSLAQQLTREATQAETE
ADRSYQHSLRLLDSVSQLQGVNDQTFQVEEAKRIKQKADSLSSLVTRHMDEFKRAQKNLG
DWKEETQQLLQNGKNGREKSDQLLSRANLAKSRAQEALSMGNATFYEVESILKNLREFDL
QVDNRKAEAEEAMKRLSYISQKVSDASDKTQQAERALGSAAADAQRAKNGAREALEISSE
IEQEIGSLNLEANVTADGALAMEKGLASLKGEMREVEGELERKELEFDTNMDAVQMVITE
AQRVDTRAKNTGVAIQDTLNTLDGLLYLMVDQPVSVDEEGLILLEQKLSRAKNQINSQLR
PMMSELEERARRQRGHLHLLETSIDGILADVKNLENIRDNLPPGCYNTPVLEQQ
Download sequence
Identical sequences ENSPANP00000008911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]