SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008921 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008921
Domain Number 1 Region: 207-239,286-360
Classification Level Classification E-value
Superfamily TPR-like 0.0000439
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008921
Domain Number - Region: 134-189
Classification Level Classification E-value
Superfamily TPR-like 0.00587
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008921   Gene: ENSPANG00000024088   Transcript: ENSPANT00000006282
Sequence length 736
Comment pep:known_by_projection chromosome:PapAnu2.0:1:44894487:44916047:-1 gene:ENSPANG00000024088 transcript:ENSPANT00000006282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARALKLLTTLLAVVAAASQAEVESEAGWGVVTPDLLFAEGTAAYARGDWPGVVLSMER
ALRSRAALRALRLRCRTRCAADFPWELDPESLPSPAQASGAAALRDLSFFGGLLRRAACL
RGCLGPPAAHSLSEEMELEFRKRSPYNYLQVAYFKINKLEKAVAAAHTFFVGNPEHMEMR
QNLDYYQTMSGVKEADFKDLETQPHMQEFRLGVRLYSEEQPQEAVPHLEAALHEYFVAYE
ECHALCEGPYDYDGYNYLEYNADLFQAITDHYIQVLSCKQNCVTELASHPSREKPFEDFL
PSHYNYLQFAYYNIGNYTQAVECAKTYLLFFPNDEVMNQNLAYYAAMLGEEHARSIGPRE
SAKEYRQRSLLEKELLFFAYDVFGIPFVDPDSWTPEEVIPKRLQEKQKSERETAVRISQE
IGNLMKEIETLVEEKTKESLDVSRLTREGGPLLYEGISLTMNSRLLNGSQRVVMDGVISD
HECQELQRLTNVAATSGDGYRGQTSPHTPNEKFYGVTVFKALKLGQEGKVPLQSAHLYYN
VTEKVRRIMESYFRLDTPLYFSYSHLVCRTAIEEVQAERKDDSHPVHVDNCILNAETLVC
VKEPPAYTFRDYSAILYLNGDFDGGNFYFTELDAKTVTAEVQPQCGRAVGFSSGTENPHG
VKAVTRGQRCAIALWFTLDPRHSERDRVQADDLVKMLFSPEEMDLSQEQPLDAQQGPPEP
AQESLSGSESKPKDEL
Download sequence
Identical sequences A0A096N8J0
ENSPANP00000008921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]