SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008922 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008922
Domain Number 1 Region: 601-968
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 8.76e-129
Family Hect, E3 ligase catalytic domain 0.00000000368
Further Details:      
 
Domain Number 2 Region: 21-159
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.26e-32
Family Synaptotagmin-like (S variant) 0.032
Further Details:      
 
Domain Number 3 Region: 185-227
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000459
Family WW domain 0.001
Further Details:      
 
Domain Number 4 Region: 544-583
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000733
Family WW domain 0.00024
Further Details:      
 
Domain Number 5 Region: 380-419
Classification Level Classification E-value
Superfamily WW domain 0.000000000000121
Family WW domain 0.0016
Further Details:      
 
Domain Number 6 Region: 498-532
Classification Level Classification E-value
Superfamily WW domain 0.000000000000376
Family WW domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008922   Gene: ENSPANG00000010022   Transcript: ENSPANT00000021374
Sequence length 975
Comment pep:known_by_projection chromosome:PapAnu2.0:18:50250769:50612621:1 gene:ENSPANG00000010022 transcript:ENSPANT00000021374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELAL
VQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDP
TMERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMPKNGGQDEENSDQRDDMEHGWEVVDSN
DSASQHQEELPPPPLPPGWEEKVDNLGRTYYVNHNNRTTQWHRPSLMDVSSESDNNIRQI
NQEAAHRRFRSRRHISEDLEPEPSEGGDVPEPWETISEEVNIAGDSLGLALPPPPASPGS
RTSPQELSEELSRRLQITPDSNGEQFSSLVQREPSSRLRSCSVTDAVAEQGHLPPPSAPA
RRARSSTVTGGEESTPSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQL
AEDGASGSATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSP
QPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSKT
SLNPNDLGPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQK
YDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLDY
GGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLA
VFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEE
NFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLI
KIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQ
FVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREK
LLMAVENAQGFEGVD
Download sequence
Identical sequences A0A2I3MRI5
ENSPANP00000008922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]