SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008929 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008929
Domain Number 1 Region: 8-84
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-19
Family PDZ domain 0.0000769
Further Details:      
 
Domain Number 2 Region: 312-341
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000363
Family LIM domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008929   Gene: ENSPANG00000022732   Transcript: ENSPANT00000011097
Sequence length 352
Comment pep:known_by_projection chromosome:PapAnu2.0:8:20526610:20548049:1 gene:ENSPANG00000022732 transcript:ENSPANT00000011097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGM
LHAEAQSKIRQSPSPLRLQLDRSQAASPGQTNGDSSLEVLATRFQGSVRTHTESHSSLRS
SYSSPTSLSPRAGSPFSPPPFSSPLAGEAAISRSFQSLACSPGLPAADRLSYSGRPGSRQ
AGLGRAGDSAVLVLPPSPGPRSSRPSVDLEGGSLLLDEDSEVFKMLQENREGRAAPRQSS
SFRLLQEALEAEERGGTPAFLPSSLSPQSSLPASRALATPPKLHTCEKCSTSIANQAVRI
QEGRYRHPGCYTCADCGLNLKMRGHFWVGDELYCEKHARQRYSAPATLSSRA
Download sequence
Identical sequences ENSPANP00000008929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]